Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06918
Gene name
Locationscaffold_08:1400019..1403017
Strand-
Gene length (bp)2998
Transcript length (bp)2466
Coding sequence length (bp)2466
Protein length (aa) 822

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 4.7E-15 379 484

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046872 metal ion binding No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046914 transition metal ion binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.378 0.81 0.0812 0.0444 0.2063 0.0358 0.0728 0.0812 0.0962 0.0148

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup713
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6248
Ophiocordyceps australis map64 (Brazil) OphauB2|7554
Ophiocordyceps camponoti-floridani Ophcf2|06918 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1928
Ophiocordyceps kimflemingae Ophio5|5964
Ophiocordyceps subramaniannii Hirsu2|1521
Ophiocordyceps subramaniannii Hirsu2|9798

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06918
MQRIGETRDEATRPTVEPGPRANTSPLAKPACLQIPTGPALWPWVLLSGPFLFPPNPPPPIHSPPVASLQRCQAL
SDSETMLGPLQDDDSAAATGHTGAVGEPSLAAGQKRQASSAAAQGPGQEPPRRPKRGKYTPLPVMSRCIAGGLVC
AYASGPPQASRRGNQNDQVRVLGEEMAQLRQQVADLVGTVQQLRHSEGPARDRSGSLHSRDATVVPSPAGAAAAG
SKDGPPKQPQFVGPTRPTFGLMVGERSLTRMGIPTFESPPPSAAPSPSEPPRDAASETDFWLRCTPEEVARLLSV
FEEEVESVYPFIDIADLASRASHTLDLLRGPAPTETPGPVSQKDVEITKIAVATALVVEAHGKSELSTTLAESVE
RHVSRIASPQVDLQGIQLLTMLSIYYFHCDDELLAWRTIGIAAREALEMGLHRKKSLFDNFKNPDARRLATRVFW
CVYVLDRRWSFGTSLSFALADRDIDPGLPEPDADFCYLKCMVGYGRLCSKLWDAIPPLGSPTQSIPDETIQALDL
STQDWLESIPPHLRLRHPRLGLAARSQPRVLQRLRALLYLRGNHTRLSIYQHCLFSTTSINSDLDTAWLVINIAQ
DSVQVLVHLNDTTDIYSRQQNAFNYFLLSALAVIFLAVCHAPNVFAEPCRKSFLDAIDLVRGFSRHSVVSRRLWK
SIRGLLPRLRSLGLQGSEDGGGGAAPAATEAATTMTTGDSPGSGRVTNADAGPENRDFRDGGIQDPPTGTSVWDG
QTSSDMMAEGDMSSSVPDMFQMRNDLLDLFDALGQGQQFPGEFGAHFYGPDEADLLNGRGGEITRRLQGLF*
Coding >Ophcf2|06918
ATGCAGCGCATTGGCGAGACGCGGGACGAGGCGACGCGGCCGACGGTGGAGCCAGGGCCGAGGGCGAACACATCA
CCGCTCGCGAAGCCTGCTTGCCTACAGATACCTACTGGGCCTGCCCTCTGGCCCTGGGTCCTCCTTTCCGGGCCA
TTTCTCTTTCCCCCGAACCCCCCCCCCCCCATTCACTCCCCCCCTGTGGCGTCCTTGCAGCGTTGTCAGGCTCTG
TCCGACTCGGAAACGATGCTCGGGCCCCTGCAGGATGACGATTCCGCCGCCGCCACGGGCCATACCGGCGCCGTT
GGCGAGCCGTCTTTAGCTGCCGGACAGAAGCGTCAGGCGTCTTCGGCAGCCGCCCAGGGTCCCGGTCAAGAGCCT
CCTCGGCGACCGAAGCGAGGGAAATACACCCCGTTGCCTGTGATGAGTCGCTGCATCGCCGGCGGCCTCGTCTGC
GCCTATGCCTCGGGCCCTCCGCAGGCCTCGCGCCGGGGAAACCAAAACGACCAGGTTCGTGTGCTGGGCGAGGAA
ATGGCTCAGTTGAGGCAACAGGTGGCGGATCTCGTCGGCACCGTTCAGCAGCTCCGGCATTCCGAAGGGCCGGCG
CGGGACCGGTCCGGCTCGCTCCATTCGCGAGACGCCACAGTCGTGCCGTCGCCCGCTGGCGCCGCCGCCGCGGGC
TCCAAGGACGGACCTCCAAAGCAGCCGCAGTTCGTGGGACCGACGCGGCCTACATTCGGCCTCATGGTTGGCGAG
CGGTCGCTTACGCGAATGGGCATCCCGACGTTCGAGTCTCCGCCTCCGAGTGCGGCGCCGTCACCGTCGGAGCCT
CCGCGGGATGCTGCGTCCGAGACTGACTTTTGGCTGCGATGTACGCCGGAAGAAGTGGCGCGGCTTCTGTCGGTC
TTTGAGGAAGAGGTCGAGTCTGTCTACCCCTTTATCGACATTGCCGATCTGGCCTCGCGTGCTTCCCATACGCTT
GACCTTCTTCGCGGCCCGGCTCCGACCGAGACGCCCGGCCCCGTGAGCCAAAAGGACGTCGAGATCACAAAGATT
GCCGTAGCGACTGCTCTAGTGGTTGAGGCTCATGGCAAGAGCGAGCTCAGTACAACGCTAGCCGAGTCGGTTGAG
CGTCATGTTTCGCGCATCGCGAGTCCTCAGGTCGACTTACAGGGGATCCAGCTGCTGACCATGCTGAGCATATAC
TACTTCCACTGCGACGACGAGCTGCTCGCCTGGCGAACCATCGGCATCGCCGCTCGCGAGGCGCTGGAGATGGGC
CTACACCGTAAGAAGAGCCTGTTTGACAACTTCAAGAACCCTGATGCGCGACGGCTGGCCACGCGCGTCTTTTGG
TGCGTTTATGTGCTGGATCGGCGCTGGAGCTTCGGCACCAGCCTTTCCTTTGCGTTGGCGGACCGTGATATCGAT
CCGGGGCTACCGGAGCCGGATGCCGACTTTTGCTATCTCAAGTGCATGGTCGGCTATGGCAGGCTGTGCTCCAAG
CTCTGGGACGCCATCCCGCCGCTCGGGTCACCGACGCAGTCAATTCCGGACGAGACGATCCAGGCGCTCGATCTC
AGCACGCAGGACTGGCTCGAGTCGATCCCGCCTCACCTCCGGCTGCGACACCCGCGTCTCGGACTCGCAGCCCGG
TCGCAGCCGCGGGTCTTGCAGCGGCTTCGGGCCCTGCTTTACCTCCGGGGAAACCACACGCGTCTGTCCATATAC
CAGCACTGCCTCTTCAGCACGACGAGCATCAACTCGGACCTTGACACCGCGTGGCTCGTCATTAATATCGCGCAG
GATAGCGTGCAGGTGCTGGTCCACCTCAACGACACGACGGACATTTACTCTCGGCAGCAAAATGCCTTCAACTAC
TTTCTCCTCAGCGCCTTGGCCGTCATCTTCCTGGCCGTGTGCCACGCGCCCAACGTCTTCGCCGAGCCGTGCCGC
AAGAGCTTTCTCGACGCCATCGACCTTGTCCGGGGCTTCTCTCGTCACAGCGTCGTCAGCCGTAGACTTTGGAAG
AGCATCCGCGGTCTGCTCCCCCGTCTGCGGAGTCTCGGGCTGCAGGGCTCTGAAGATGGCGGAGGCGGGGCGGCA
CCGGCTGCGACGGAGGCGGCCACGACGATGACGACGGGCGATAGTCCCGGCTCCGGAAGAGTCACCAACGCCGAC
GCCGGGCCGGAGAATCGGGATTTCCGAGACGGGGGCATACAGGATCCGCCGACGGGGACGAGCGTATGGGACGGC
CAGACGAGCAGTGATATGATGGCCGAGGGCGACATGTCGAGCTCCGTGCCGGACATGTTCCAGATGCGTAACGAC
CTGCTCGACCTGTTTGACGCCCTCGGACAGGGGCAGCAGTTTCCTGGCGAGTTCGGGGCGCACTTTTACGGGCCG
GACGAGGCGGACTTGCTCAACGGACGGGGAGGGGAGATCACTCGTCGGTTGCAGGGTTTGTTTTGA
Transcript >Ophcf2|06918
ATGCAGCGCATTGGCGAGACGCGGGACGAGGCGACGCGGCCGACGGTGGAGCCAGGGCCGAGGGCGAACACATCA
CCGCTCGCGAAGCCTGCTTGCCTACAGATACCTACTGGGCCTGCCCTCTGGCCCTGGGTCCTCCTTTCCGGGCCA
TTTCTCTTTCCCCCGAACCCCCCCCCCCCCATTCACTCCCCCCCTGTGGCGTCCTTGCAGCGTTGTCAGGCTCTG
TCCGACTCGGAAACGATGCTCGGGCCCCTGCAGGATGACGATTCCGCCGCCGCCACGGGCCATACCGGCGCCGTT
GGCGAGCCGTCTTTAGCTGCCGGACAGAAGCGTCAGGCGTCTTCGGCAGCCGCCCAGGGTCCCGGTCAAGAGCCT
CCTCGGCGACCGAAGCGAGGGAAATACACCCCGTTGCCTGTGATGAGTCGCTGCATCGCCGGCGGCCTCGTCTGC
GCCTATGCCTCGGGCCCTCCGCAGGCCTCGCGCCGGGGAAACCAAAACGACCAGGTTCGTGTGCTGGGCGAGGAA
ATGGCTCAGTTGAGGCAACAGGTGGCGGATCTCGTCGGCACCGTTCAGCAGCTCCGGCATTCCGAAGGGCCGGCG
CGGGACCGGTCCGGCTCGCTCCATTCGCGAGACGCCACAGTCGTGCCGTCGCCCGCTGGCGCCGCCGCCGCGGGC
TCCAAGGACGGACCTCCAAAGCAGCCGCAGTTCGTGGGACCGACGCGGCCTACATTCGGCCTCATGGTTGGCGAG
CGGTCGCTTACGCGAATGGGCATCCCGACGTTCGAGTCTCCGCCTCCGAGTGCGGCGCCGTCACCGTCGGAGCCT
CCGCGGGATGCTGCGTCCGAGACTGACTTTTGGCTGCGATGTACGCCGGAAGAAGTGGCGCGGCTTCTGTCGGTC
TTTGAGGAAGAGGTCGAGTCTGTCTACCCCTTTATCGACATTGCCGATCTGGCCTCGCGTGCTTCCCATACGCTT
GACCTTCTTCGCGGCCCGGCTCCGACCGAGACGCCCGGCCCCGTGAGCCAAAAGGACGTCGAGATCACAAAGATT
GCCGTAGCGACTGCTCTAGTGGTTGAGGCTCATGGCAAGAGCGAGCTCAGTACAACGCTAGCCGAGTCGGTTGAG
CGTCATGTTTCGCGCATCGCGAGTCCTCAGGTCGACTTACAGGGGATCCAGCTGCTGACCATGCTGAGCATATAC
TACTTCCACTGCGACGACGAGCTGCTCGCCTGGCGAACCATCGGCATCGCCGCTCGCGAGGCGCTGGAGATGGGC
CTACACCGTAAGAAGAGCCTGTTTGACAACTTCAAGAACCCTGATGCGCGACGGCTGGCCACGCGCGTCTTTTGG
TGCGTTTATGTGCTGGATCGGCGCTGGAGCTTCGGCACCAGCCTTTCCTTTGCGTTGGCGGACCGTGATATCGAT
CCGGGGCTACCGGAGCCGGATGCCGACTTTTGCTATCTCAAGTGCATGGTCGGCTATGGCAGGCTGTGCTCCAAG
CTCTGGGACGCCATCCCGCCGCTCGGGTCACCGACGCAGTCAATTCCGGACGAGACGATCCAGGCGCTCGATCTC
AGCACGCAGGACTGGCTCGAGTCGATCCCGCCTCACCTCCGGCTGCGACACCCGCGTCTCGGACTCGCAGCCCGG
TCGCAGCCGCGGGTCTTGCAGCGGCTTCGGGCCCTGCTTTACCTCCGGGGAAACCACACGCGTCTGTCCATATAC
CAGCACTGCCTCTTCAGCACGACGAGCATCAACTCGGACCTTGACACCGCGTGGCTCGTCATTAATATCGCGCAG
GATAGCGTGCAGGTGCTGGTCCACCTCAACGACACGACGGACATTTACTCTCGGCAGCAAAATGCCTTCAACTAC
TTTCTCCTCAGCGCCTTGGCCGTCATCTTCCTGGCCGTGTGCCACGCGCCCAACGTCTTCGCCGAGCCGTGCCGC
AAGAGCTTTCTCGACGCCATCGACCTTGTCCGGGGCTTCTCTCGTCACAGCGTCGTCAGCCGTAGACTTTGGAAG
AGCATCCGCGGTCTGCTCCCCCGTCTGCGGAGTCTCGGGCTGCAGGGCTCTGAAGATGGCGGAGGCGGGGCGGCA
CCGGCTGCGACGGAGGCGGCCACGACGATGACGACGGGCGATAGTCCCGGCTCCGGAAGAGTCACCAACGCCGAC
GCCGGGCCGGAGAATCGGGATTTCCGAGACGGGGGCATACAGGATCCGCCGACGGGGACGAGCGTATGGGACGGC
CAGACGAGCAGTGATATGATGGCCGAGGGCGACATGTCGAGCTCCGTGCCGGACATGTTCCAGATGCGTAACGAC
CTGCTCGACCTGTTTGACGCCCTCGGACAGGGGCAGCAGTTTCCTGGCGAGTTCGGGGCGCACTTTTACGGGCCG
GACGAGGCGGACTTGCTCAACGGACGGGGAGGGGAGATCACTCGTCGGTTGCAGGGTTTGTTTTGA
Gene >Ophcf2|06918
ATGCAGCGCATTGGCGAGACGCGGGACGAGGCGACGCGGCCGACGGTGGAGCCAGGGCCGGTAATTCGGAACGGC
GGAAAGGCGAAGCCGACGAGGCCGACGTTGCTCAAAGCTTGACTCCGTTTTCTTTCTTCCCTCGGCGGCCGCCTG
AGAGGGCGAACACATGTATTTTATTTCTGTTTTTATTTTTACTTTTATTTTCATTTTTGGCCTGCTAACGCATTG
ATAGCACCGCTCGCGAAGCCTGCTTGCCTACAGATACCTACTGGGCCTGCCCTCTGGCCCTGGGTCCTCCTTTCC
GGGCCATTTCTCTTTCCCCCGAACCCCCCCCCCCCCATTCACTCCCCCCCTGTGGCGTCCTTGCAGCGTTGTCAG
GCTCTGTCCGACTCGGAAACGATGCTCGGGCCCCTGCAGGATGACGATTCCGCCGCCGCCACGGGCCATACCGGC
GCCGTTGGCGAGCCGTCTTTAGCTGCCGGACAGAAGCGTCAGGCGTCTTCGGCAGCCGCCCAGGGTCCCGGTCAA
GAGCCTCCTCGGCGACCGAAGCGAGGGAAATACACCCCGTTGCCTGGTAGCTCAACCCTCCCCCCCCCCCCCCCC
CCCTCTTCCTCTCCTACTCATCCCTCCCCTTCCTGTCTCCGTTTCCTTGCCACCGTTTTCTTTCCGAGCGGATGG
CTGTATCCCCTGGTGGCTTCTAGGCAGCGACGGCTGTTGTCGACTCCTTCTAAGCCTGCCTCGTCCACTACACAC
ACACACACACACACACACACTGCTGACTGTCCGCCTCAAGTGATGAGTGTAAGAAGCGCAAACTCAAGTGCATCC
CGGCCGGAGACGCTGGCTGCGAGCGCTGCATCGCCGGCGGCCTCGTCTGCGCCTATGCCTCGGGCCCTCCGCAGG
CCTCGCGCCGGGGAAACCAAAACGACCAGGTTCGTGTGCTGGGCGAGGAAATGGCTCAGTTGAGGCAACAGGTGG
CGGATCTCGTCGGCACCGTTCAGCAGCTCCGGCATTCCGAAGGGCCGGCGCGGGACCGGTCCGGCTCGCTCCATT
CGCGAGACGCCACAGTCGTGCCGTCGCCCGCTGGCGCCGCCGCCGCGGGCTCCAAGGACGGACCTCCAAAGCAGC
CGCAGTTCGTGGGACCGACGCGGCCTACATTCGGCCTCATGGTTGGCGAGCGGTCGCTTACGCGAATGGGCATCC
CGACGTTCGAGTCTCCGCCTCCGAGTGCGGCGCCGTCACCGTCGGAGCCTCCGCGGGATGCTGCGTCCGAGACTG
ACTTTTGGCTGCGATGTACGCCGGAAGAAGTGGCGCGGCTTCTGTCGGTCTTTGAGGAAGAGGTCGAGTCTGTCT
ACCCCTTTATCGACATTGCCGATCTGGCCTCGCGTGCTTCCCATACGCTTGACCTTCTTCGCGGCCCGGCTCCGA
CCGAGACGCCCGGCCCCGTGAGCCAAAAGGACGTCGAGATCACAAAGATTGCCGTAGCGACTGCTCTAGTGGTTG
AGGCTCATGGCAAGAGCGAGCTCAGTACAACGCTAGCCGAGTCGGTTGAGCGTCATGTTTCGCGCATCGCGAGTC
CTCAGGTCGACTTACAGGGGATCCAGCTGCTGACCATGCTGGTGGGACTTTTTGTTTCCCTCGCCGTCATCTGTT
CGTAGGGCTAACGGCGCTGGCAGAGCATATACTACTTCCACTGCGACGACGAGCTGCTCGCCTGGCGAACCATCG
GCATCGCCGCTCGCGAGGCGCTGGAGATGGGCCTACACCGTAAGAAGAGCCTGTTTGACAACTTCAAGAACCCTG
ATGCGCGACGGCTGGCCACGCGCGTCTTTTGGTGCGTTTATGTGCTGGATCGGCGCTGGAGCTTCGGCACCAGCC
TTTCCTTTGCGTTGGCGGACCGTGATATCGATCCGGGGCTACCGGAGCCGGTGAGTTCGTTGGTCATGGAGATGA
GGTCTATTCGCTGACAGGGTCTCAGGATGCCGACTTTTGCTATCTCAAGTGCATGGTCGGCTATGGCAGGCTGTG
CTCCAAGCTCTGGGACGCCATCCCGCCGCTCGGGTCACCGACGCAGTCAATTCCGGACGAGACGATCCAGGCGCT
CGATCTCAGCACGCAGGACTGGCTCGAGTCGATCCCGCCTCACCTCCGGCTGCGACACCCGCGTCTCGGACTCGC
AGCCCGGTCGCAGCCGCGGGTCTTGCAGCGGCTTCGGGCCCTGCTTTACCTCCGGGGAAACCACACGCGTCTGTC
CATATACCAGCACTGCCTCTTCAGCACGACGAGCATCAACTCGGACCTTGACACCGCGTGGCTCGTCATTAATAT
CGCGCAGGATAGCGTGCAGGTGCTGGTCCACCTCAACGACACGACGGACATTTACTCTCGGCAGCAAAATGCCTT
CAACTACTTTCTCCTCAGCGCCTTGGCCGTCATCTTCCTGGCCGTGTGCCACGCGCCCAACGTCTTCGCCGAGCC
GTGCCGCAAGAGCTTTCTCGACGCCATCGACCTTGTCCGGGGCTTCTCTCGTCACAGCGTCGTCAGCCGTAGACT
TTGGAAGAGCATCCGCGGTCTGCTCCCCCGTCTGCGGAGTCTCGGGCTGCAGGGCTCTGAAGATGGCGGAGGCGG
GGCGGCACCGGCTGCGACGGAGGCGGCCACGACGATGACGACGGGCGATAGTCCCGGCTCCGGAAGAGTCACCAA
CGCCGACGCCGGGCCGGAGAATCGGGATTTCCGAGACGGGGGCATACAGGATCCGCCGACGGGGACGAGCGTATG
GGACGGCCAGACGAGCAGTGATATGATGGCCGAGGGCGACATGTCGAGCTCCGTGCCGGACATGTTCCAGATGCG
TAACGACCTGCTCGACCTGTTTGACGCCCTCGGACAGGGGCAGCAGTTTCCTGGCGAGTTCGGGGCGCACTTTTA
CGGGCCGGACGAGGCGGACTTGCTCAACGGACGGGGAGGGGAGATCACTCGTCGGTTGCAGGGTTTGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail