Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06916
Gene name
Locationscaffold_08:1396606..1398224
Strand-
Gene length (bp)1618
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 4.2E-158 29 490

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7985 0.2926 0.202 0.0404 0.2346 0.0136 0.1074 0.0859 0.1621 0.194

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup34
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|802
Ophiocordyceps australis 1348a (Ghana) OphauG2|6251
Ophiocordyceps australis 1348a (Ghana) OphauG2|877
Ophiocordyceps australis map64 (Brazil) OphauB2|293
Ophiocordyceps australis map64 (Brazil) OphauB2|4792
Ophiocordyceps australis map64 (Brazil) OphauB2|7552
Ophiocordyceps australis map64 (Brazil) OphauB2|8056
Ophiocordyceps camponoti-floridani Ophcf2|06916 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04936
Ophiocordyceps camponoti-floridani Ophcf2|00035
Ophiocordyceps camponoti-rufipedis Ophun1|1383
Ophiocordyceps camponoti-rufipedis Ophun1|3814
Ophiocordyceps camponoti-rufipedis Ophun1|2638
Ophiocordyceps kimflemingae Ophio5|2172
Ophiocordyceps kimflemingae Ophio5|2565
Ophiocordyceps kimflemingae Ophio5|4620
Ophiocordyceps kimflemingae Ophio5|5966
Ophiocordyceps subramaniannii Hirsu2|9800
Ophiocordyceps subramaniannii Hirsu2|873
Ophiocordyceps subramaniannii Hirsu2|6976
Ophiocordyceps subramaniannii Hirsu2|1193
Ophiocordyceps subramaniannii Hirsu2|11029

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06916
MAEIVLVGAGGRQITVPTGLFIDNDFSEASQGKTIDLEKPASGSFLATVAAAQAQDVDRAVASSEAAFESVWRTE
AASRARGLLNKLADLIERDAEDLASLEALDAGMLYRESLGLSVAQAAETCRYYAGWVGKLDGRAMGISQGMAYTR
RQPFGVCAAIVPWNAPLMITVWKLAPAVAAGNTLIIKTPEAAPLYGQKLAELIKEAGFPPGVINILCGLGPVAGQ
ALADHGSVRKISFTGSGAVGRRILQSSARTNLKRVTTELGGKGPSIVFDDADWENALLHTTMGITAHNGQICAAG
SRIYVQDKIFDRFVAEFSTRTKDSVMGDPLLDETTKGPLINAAQVSRVKGYVQGALKEGHRLLHGGEEETPEKGT
SGHFVPNTAFVDVPATATIMREEVFGPVASIARFKTEDEAIKLANDSSLGLSAAVFTNDISRAVRVSDAIQCGQV
TVNMWGAINVNVPFGGFKESGIGRDLGLEAAEEWTEVKSVKLNILPRL*
Coding >Ophcf2|06916
ATGGCGGAAATCGTCTTGGTCGGCGCGGGTGGGCGCCAAATCACCGTTCCCACCGGCCTTTTCATAGACAACGAC
TTTTCCGAGGCGTCTCAGGGCAAGACAATCGACCTGGAGAAGCCAGCCAGCGGATCCTTTCTCGCAACCGTGGCA
GCCGCCCAGGCCCAAGACGTAGACCGGGCCGTTGCCTCGTCCGAGGCGGCCTTTGAGTCGGTATGGCGGACCGAG
GCAGCCAGCAGGGCCAGAGGCCTTCTGAATAAGCTGGCCGATCTCATCGAGCGTGATGCTGAGGACTTGGCCTCG
CTCGAGGCCTTGGACGCCGGCATGCTTTACCGTGAGTCTCTGGGCCTCAGCGTGGCGCAGGCGGCCGAGACGTGT
CGGTATTATGCGGGATGGGTTGGCAAGCTCGACGGACGTGCCATGGGCATCTCGCAGGGTATGGCTTATACCCGT
CGCCAGCCCTTTGGCGTGTGTGCTGCCATTGTGCCGTGGAACGCTCCCCTCATGATTACGGTGTGGAAGCTGGCG
CCGGCAGTGGCGGCGGGCAACACGCTCATCATCAAGACGCCTGAAGCGGCCCCCTTGTACGGCCAGAAGCTGGCA
GAGCTAATCAAGGAGGCCGGCTTCCCACCGGGCGTCATCAACATTCTTTGCGGTTTGGGCCCTGTCGCCGGCCAA
GCGCTTGCGGATCACGGCTCGGTGCGCAAGATCTCCTTTACTGGGAGCGGTGCTGTCGGGAGACGCATCCTGCAG
AGCTCTGCGCGGACGAACCTGAAGAGGGTGACGACGGAGCTTGGTGGCAAGGGTCCCAGCATCGTCTTTGATGAC
GCTGACTGGGAGAATGCGTTGTTACATACCACGATGGGCATCACGGCTCATAACGGGCAGATTTGCGCGGCGGGG
AGTCGCATCTACGTTCAGGACAAAATATTCGACCGCTTCGTTGCCGAGTTTTCTACTCGGACTAAGGATTCCGTC
ATGGGAGATCCGCTGCTCGACGAGACGACCAAGGGCCCTCTTATAAACGCCGCCCAGGTGAGCCGGGTCAAAGGT
TACGTCCAGGGGGCGCTCAAGGAGGGTCACCGTCTGCTTCACGGTGGCGAGGAGGAGACTCCAGAGAAGGGAACG
AGCGGCCACTTTGTGCCCAACACGGCCTTTGTCGACGTCCCTGCCACGGCGACGATCATGCGCGAAGAGGTCTTC
GGCCCCGTAGCCAGCATCGCGCGCTTCAAGACGGAAGACGAGGCCATCAAGTTGGCCAATGATAGCAGCCTTGGA
CTCTCGGCCGCTGTCTTCACAAACGATATCAGCAGGGCGGTGCGCGTCAGCGATGCCATCCAGTGCGGCCAGGTG
ACGGTCAACATGTGGGGGGCCATCAACGTCAACGTGCCTTTTGGTGGCTTCAAGGAGAGTGGCATCGGGAGGGAT
CTCGGGTTGGAGGCGGCGGAGGAGTGGACCGAGGTGAAGAGCGTCAAGCTGAATATTCTGCCGAGGTTGTAG
Transcript >Ophcf2|06916
ATGGCGGAAATCGTCTTGGTCGGCGCGGGTGGGCGCCAAATCACCGTTCCCACCGGCCTTTTCATAGACAACGAC
TTTTCCGAGGCGTCTCAGGGCAAGACAATCGACCTGGAGAAGCCAGCCAGCGGATCCTTTCTCGCAACCGTGGCA
GCCGCCCAGGCCCAAGACGTAGACCGGGCCGTTGCCTCGTCCGAGGCGGCCTTTGAGTCGGTATGGCGGACCGAG
GCAGCCAGCAGGGCCAGAGGCCTTCTGAATAAGCTGGCCGATCTCATCGAGCGTGATGCTGAGGACTTGGCCTCG
CTCGAGGCCTTGGACGCCGGCATGCTTTACCGTGAGTCTCTGGGCCTCAGCGTGGCGCAGGCGGCCGAGACGTGT
CGGTATTATGCGGGATGGGTTGGCAAGCTCGACGGACGTGCCATGGGCATCTCGCAGGGTATGGCTTATACCCGT
CGCCAGCCCTTTGGCGTGTGTGCTGCCATTGTGCCGTGGAACGCTCCCCTCATGATTACGGTGTGGAAGCTGGCG
CCGGCAGTGGCGGCGGGCAACACGCTCATCATCAAGACGCCTGAAGCGGCCCCCTTGTACGGCCAGAAGCTGGCA
GAGCTAATCAAGGAGGCCGGCTTCCCACCGGGCGTCATCAACATTCTTTGCGGTTTGGGCCCTGTCGCCGGCCAA
GCGCTTGCGGATCACGGCTCGGTGCGCAAGATCTCCTTTACTGGGAGCGGTGCTGTCGGGAGACGCATCCTGCAG
AGCTCTGCGCGGACGAACCTGAAGAGGGTGACGACGGAGCTTGGTGGCAAGGGTCCCAGCATCGTCTTTGATGAC
GCTGACTGGGAGAATGCGTTGTTACATACCACGATGGGCATCACGGCTCATAACGGGCAGATTTGCGCGGCGGGG
AGTCGCATCTACGTTCAGGACAAAATATTCGACCGCTTCGTTGCCGAGTTTTCTACTCGGACTAAGGATTCCGTC
ATGGGAGATCCGCTGCTCGACGAGACGACCAAGGGCCCTCTTATAAACGCCGCCCAGGTGAGCCGGGTCAAAGGT
TACGTCCAGGGGGCGCTCAAGGAGGGTCACCGTCTGCTTCACGGTGGCGAGGAGGAGACTCCAGAGAAGGGAACG
AGCGGCCACTTTGTGCCCAACACGGCCTTTGTCGACGTCCCTGCCACGGCGACGATCATGCGCGAAGAGGTCTTC
GGCCCCGTAGCCAGCATCGCGCGCTTCAAGACGGAAGACGAGGCCATCAAGTTGGCCAATGATAGCAGCCTTGGA
CTCTCGGCCGCTGTCTTCACAAACGATATCAGCAGGGCGGTGCGCGTCAGCGATGCCATCCAGTGCGGCCAGGTG
ACGGTCAACATGTGGGGGGCCATCAACGTCAACGTGCCTTTTGGTGGCTTCAAGGAGAGTGGCATCGGGAGGGAT
CTCGGGTTGGAGGCGGCGGAGGAGTGGACCGAGGTGAAGAGCGTCAAGCTGAATATTCTGCCGAGGTTGTAG
Gene >Ophcf2|06916
ATGGCGGAAATCGTCTTGGTCGGCGCGGGTGGGCGCCAAATCACCGGTGAGCAATGCTGCCATCTTTACCAGCTG
AACAGGTCATGACCAATTCGTCAGTTCCCACCGGCCTTTTCATAGACAACGACTTTTCCGAGGCGTCTCAGGGCA
AGACAATCGACCTGGAGAAGCCAGCCAGCGGATCCTTTCTCGCAACCGTGGCAGCCGCCCAGGCCCAAGACGTAG
ACCGGGCCGTTGCCTCGTCCGAGGCGGCCTTTGAGTCGGTATGGCGGACCGAGGCAGCCAGCAGGGCCAGAGGCC
TTCTGAATAAGCTGGCCGATCTCATCGAGCGTGATGCTGAGGACTTGGCCTCGCTCGAGGCCTTGGACGCCGGCA
TGCTTTACCGTGAGTCTCTGGGCCTCAGCGTGGCGCAGGCGGCCGAGACGTGTCGGTATTATGCGGGATGGGTTG
GCAAGCTCGACGGACGTGCCATGGGCATCTCGCAGGGTATGGCTTATACCCGTCGCCAGCCCTTTGGCGTGTGTG
CTGCCATTGTGCCGTGGAACGCTCCCCTGTGAGCCCAGAAGACCGTGCTCCTATCAGAAGACGGCGCTGACTCTC
GTCTTCGCTCTTGAAATCTAGCATGATTACGGTGTGGAAGCTGGCGCCGGCAGTGGCGGCGGGCAACACGCTCAT
CATCAAGACGCCTGAAGCGGCCCCCTTGTACGGCCAGAAGCTGGCAGAGCTAATCAAGGAGGCCGGCTTCCCACC
GGGCGTCATCAACATTCTTTGCGGTTTGGGCCCTGTCGCCGGCCAAGCGCTTGCGGATCACGGCTCGGTGCGCAA
GATCTCCTTTACTGGGAGCGGTGCTGTCGGGAGACGCATCCTGCAGAGCTCTGCGCGGACGAACCTGAAGAGGGT
GACGACGGAGCTTGGTGGCAAGGGTCCCAGCATCGTCTTTGATGACGCTGACTGGGAGAATGCGTTGTTACATAC
CACGATGGGCATCACGGCTCATAACGGGCAGATTTGCGCGGCGGGGAGTCGCATCTACGTTCAGGACAAAATATT
CGACCGCTTCGTTGCCGAGTTTTCTACTCGGACTAAGGATTCCGTCATGGGAGATCCGCTGCTCGACGAGACGAC
CAAGGGCCCTCTTATAAACGCCGCCCAGGTGAGCCGGGTCAAAGGTTACGTCCAGGGGGCGCTCAAGGAGGGTCA
CCGTCTGCTTCACGGTGGCGAGGAGGAGACTCCAGAGAAGGGAACGAGCGGCCACTTTGTGCCCAACACGGCCTT
TGTCGACGTCCCTGCCACGGCGACGATCATGCGCGAAGAGGTCTTCGGCCCCGTAGCCAGCATCGCGCGCTTCAA
GACGGAAGACGAGGCCATCAAGTTGGCCAATGATAGCAGCCTTGGACTCTCGGCCGCTGTCTTCACAAACGATAT
CAGCAGGGCGGTGCGCGTCAGCGATGCCATCCAGTGCGGCCAGGTGACGGTCAACATGTGGGGGGCCATCAACGT
CAACGTGCCTTTTGGTGGCTTCAAGGAGAGTGGCATCGGGAGGGATCTCGGGTTGGAGGCGGCGGAGGAGTGGAC
CGAGGTGAAGAGCGTCAAGCTGAATATTCTGCCGAGGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail