Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06915
Gene name
Locationscaffold_08:1394077..1396318
Strand+
Gene length (bp)2241
Transcript length (bp)2025
Coding sequence length (bp)2025
Protein length (aa) 675

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain 6.0E-159 246 646
PF02728 Cu_amine_oxidN3 Copper amine oxidase, N3 domain 2.9E-05 111 203

GO

GO Term Description Terminal node
GO:0009308 amine metabolic process Yes
GO:0005507 copper ion binding Yes
GO:0008131 primary amine oxidase activity Yes
GO:0048038 quinone binding Yes
GO:0046872 metal ion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.4988 0.1257 0.3961 0.1043 0.1121 0.0073 0.1094 0.1969 0.063 0.969

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup60
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6252
Ophiocordyceps australis map64 (Brazil) OphauB2|7551
Ophiocordyceps camponoti-floridani Ophcf2|03843
Ophiocordyceps camponoti-floridani Ophcf2|06915 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03099
Ophiocordyceps camponoti-rufipedis Ophun1|1382
Ophiocordyceps camponoti-rufipedis Ophun1|320
Ophiocordyceps camponoti-rufipedis Ophun1|3694
Ophiocordyceps kimflemingae Ophio5|4618
Ophiocordyceps kimflemingae Ophio5|5158
Ophiocordyceps kimflemingae Ophio5|5967
Ophiocordyceps kimflemingae Ophio5|6024
Ophiocordyceps subramaniannii Hirsu2|9792
Ophiocordyceps subramaniannii Hirsu2|1941
Ophiocordyceps subramaniannii Hirsu2|10669
Ophiocordyceps subramaniannii Hirsu2|9801
Ophiocordyceps subramaniannii Hirsu2|10668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06915
MSQPHPLSGLTADEINRARDVVLRLHPGTVIDFRSIFLLEPPKAEVVPFLALEHAGKVTASTPRPARLAQAWYDV
IGGSQAAEYHESVIDVGAAKRVGHKVVPTEHHAGLTVFEFKKLLECVKTSPLFQEKLKAFRLPPGFELVVEPWPY
GAPDTTDGNTRLFQCLCFARNTASGKDSNFYSYPIPLIPVMDYWKNEVVRVDEPATGGGSDPLVGRPKNAAIVDH
CKPAEYVPELVRTRTDVKPLTVVQPQGPSFTVSDSSLIEWQKWRMRVSFNPREGAVLHDIRYDGREVLYRLSISD
MTVPYADPRTPYHRKQAFDFGDGGLGHAVNNLKLGCDCLGVIKYLDGVLTTDDGSAQTSKNVICIHEQDNGINWK
HTDWRTGRATVTRRRELVVQFIITLANYEYIFAFKFDQAAGIVVEARATGIVSVVNIDEGKTAPWGNVVGPGALA
QNHQHIFCVRVDPAVDGHRNTLVQEDSLPVAMNERTSPHGNFYEVRKTPIATSCGLDLAPFSNRVFKVQNQAKRN
PVSGRPVGYKITAPPTQLLLADPRSVQAQRALFAKHHLWVTKFKDDELYAGGRHTLQSRLEVGGVADAAARGEDV
LDDDIVIWSVFGLTHNPRVEDWPVMPVEMLQVHITPSDFFTENPSIDVPSNADIGSRNVTDGCCEGKATEKSRL*
Coding >Ophcf2|06915
ATGTCTCAGCCGCATCCCCTGTCCGGTCTCACGGCCGATGAGATCAATCGTGCCCGTGACGTCGTGCTGAGGCTA
CATCCGGGCACAGTCATCGACTTCCGCTCCATCTTCCTGCTGGAGCCGCCCAAGGCCGAGGTCGTTCCCTTTCTC
GCGCTCGAACATGCGGGAAAAGTCACGGCCAGCACGCCCCGGCCGGCGAGGCTGGCGCAGGCCTGGTACGACGTG
ATTGGCGGATCGCAGGCTGCCGAGTATCACGAGTCCGTCATCGATGTCGGCGCGGCCAAGCGTGTTGGCCACAAG
GTCGTTCCGACGGAGCATCACGCCGGACTGACCGTCTTCGAGTTTAAAAAGCTGCTCGAATGCGTCAAGACGTCA
CCGCTCTTCCAGGAGAAGCTCAAAGCCTTCCGGCTGCCCCCCGGCTTCGAGCTCGTCGTCGAGCCCTGGCCGTAC
GGAGCGCCAGACACGACCGACGGCAACACCCGCCTGTTCCAGTGCCTCTGCTTCGCCCGCAACACCGCCAGCGGC
AAAGACTCAAACTTTTACTCTTATCCCATCCCTCTGATTCCGGTCATGGACTACTGGAAGAACGAGGTCGTCCGC
GTCGACGAACCGGCAACGGGCGGTGGCTCAGATCCCCTCGTCGGACGCCCCAAGAACGCAGCCATCGTCGACCAC
TGCAAGCCGGCCGAATACGTGCCAGAGCTTGTCCGCACGAGAACCGACGTGAAGCCCCTGACGGTGGTGCAGCCT
CAGGGACCGAGCTTTACCGTCTCAGACTCGAGCCTCATCGAGTGGCAGAAGTGGCGGATGCGAGTGTCTTTCAAC
CCGCGGGAGGGCGCCGTCCTTCACGATATCCGCTACGATGGCCGCGAAGTCCTCTACAGGCTGAGCATCAGCGAC
ATGACGGTGCCATATGCCGATCCGCGGACGCCGTATCATCGCAAGCAGGCCTTTGACTTTGGTGACGGTGGTCTT
GGACACGCCGTAAACAACCTCAAACTCGGCTGCGACTGCTTGGGCGTCATCAAGTACCTAGATGGCGTCCTTACC
ACCGATGACGGCTCAGCCCAGACATCCAAGAACGTCATATGCATCCACGAGCAAGACAATGGCATCAACTGGAAG
CACACGGACTGGCGGACGGGTCGCGCCACAGTAACTCGTCGCCGCGAACTGGTGGTGCAGTTCATCATCACTCTG
GCCAACTACGAGTACATCTTCGCCTTCAAGTTCGACCAGGCAGCCGGCATCGTCGTCGAGGCTCGCGCCACGGGC
ATAGTCTCCGTCGTCAACATAGACGAGGGCAAGACGGCTCCCTGGGGCAACGTCGTCGGCCCCGGCGCCCTGGCG
CAGAATCACCAACACATCTTCTGCGTCCGTGTTGATCCCGCCGTCGACGGGCACCGGAACACGCTGGTGCAGGAG
GATAGTCTCCCCGTAGCCATGAACGAACGCACCAGCCCGCACGGTAACTTTTACGAGGTACGCAAGACGCCCATC
GCCACGTCGTGCGGACTCGACCTCGCTCCCTTTAGCAACCGCGTCTTCAAGGTCCAGAACCAGGCAAAGAGGAAC
CCGGTCAGCGGGAGACCGGTAGGTTACAAGATTACCGCGCCGCCGACGCAGCTCCTGCTGGCGGATCCCCGGAGC
GTCCAGGCACAGCGGGCGCTGTTCGCCAAGCATCATCTCTGGGTTACCAAGTTCAAGGACGACGAGCTGTACGCC
GGTGGACGCCACACGCTTCAGAGCCGGCTAGAGGTGGGAGGCGTTGCCGACGCGGCGGCACGTGGCGAAGACGTG
TTGGACGACGACATCGTCATCTGGTCCGTCTTTGGTCTGACGCATAACCCTCGAGTCGAAGACTGGCCTGTCATG
CCCGTGGAGATGCTACAGGTGCACATTACGCCGTCAGATTTCTTCACTGAGAATCCGTCCATCGATGTTCCGTCC
AACGCGGACATTGGCTCACGGAACGTGACAGATGGGTGCTGCGAGGGCAAGGCGACGGAAAAGTCTCGGTTGTGA
Transcript >Ophcf2|06915
ATGTCTCAGCCGCATCCCCTGTCCGGTCTCACGGCCGATGAGATCAATCGTGCCCGTGACGTCGTGCTGAGGCTA
CATCCGGGCACAGTCATCGACTTCCGCTCCATCTTCCTGCTGGAGCCGCCCAAGGCCGAGGTCGTTCCCTTTCTC
GCGCTCGAACATGCGGGAAAAGTCACGGCCAGCACGCCCCGGCCGGCGAGGCTGGCGCAGGCCTGGTACGACGTG
ATTGGCGGATCGCAGGCTGCCGAGTATCACGAGTCCGTCATCGATGTCGGCGCGGCCAAGCGTGTTGGCCACAAG
GTCGTTCCGACGGAGCATCACGCCGGACTGACCGTCTTCGAGTTTAAAAAGCTGCTCGAATGCGTCAAGACGTCA
CCGCTCTTCCAGGAGAAGCTCAAAGCCTTCCGGCTGCCCCCCGGCTTCGAGCTCGTCGTCGAGCCCTGGCCGTAC
GGAGCGCCAGACACGACCGACGGCAACACCCGCCTGTTCCAGTGCCTCTGCTTCGCCCGCAACACCGCCAGCGGC
AAAGACTCAAACTTTTACTCTTATCCCATCCCTCTGATTCCGGTCATGGACTACTGGAAGAACGAGGTCGTCCGC
GTCGACGAACCGGCAACGGGCGGTGGCTCAGATCCCCTCGTCGGACGCCCCAAGAACGCAGCCATCGTCGACCAC
TGCAAGCCGGCCGAATACGTGCCAGAGCTTGTCCGCACGAGAACCGACGTGAAGCCCCTGACGGTGGTGCAGCCT
CAGGGACCGAGCTTTACCGTCTCAGACTCGAGCCTCATCGAGTGGCAGAAGTGGCGGATGCGAGTGTCTTTCAAC
CCGCGGGAGGGCGCCGTCCTTCACGATATCCGCTACGATGGCCGCGAAGTCCTCTACAGGCTGAGCATCAGCGAC
ATGACGGTGCCATATGCCGATCCGCGGACGCCGTATCATCGCAAGCAGGCCTTTGACTTTGGTGACGGTGGTCTT
GGACACGCCGTAAACAACCTCAAACTCGGCTGCGACTGCTTGGGCGTCATCAAGTACCTAGATGGCGTCCTTACC
ACCGATGACGGCTCAGCCCAGACATCCAAGAACGTCATATGCATCCACGAGCAAGACAATGGCATCAACTGGAAG
CACACGGACTGGCGGACGGGTCGCGCCACAGTAACTCGTCGCCGCGAACTGGTGGTGCAGTTCATCATCACTCTG
GCCAACTACGAGTACATCTTCGCCTTCAAGTTCGACCAGGCAGCCGGCATCGTCGTCGAGGCTCGCGCCACGGGC
ATAGTCTCCGTCGTCAACATAGACGAGGGCAAGACGGCTCCCTGGGGCAACGTCGTCGGCCCCGGCGCCCTGGCG
CAGAATCACCAACACATCTTCTGCGTCCGTGTTGATCCCGCCGTCGACGGGCACCGGAACACGCTGGTGCAGGAG
GATAGTCTCCCCGTAGCCATGAACGAACGCACCAGCCCGCACGGTAACTTTTACGAGGTACGCAAGACGCCCATC
GCCACGTCGTGCGGACTCGACCTCGCTCCCTTTAGCAACCGCGTCTTCAAGGTCCAGAACCAGGCAAAGAGGAAC
CCGGTCAGCGGGAGACCGGTAGGTTACAAGATTACCGCGCCGCCGACGCAGCTCCTGCTGGCGGATCCCCGGAGC
GTCCAGGCACAGCGGGCGCTGTTCGCCAAGCATCATCTCTGGGTTACCAAGTTCAAGGACGACGAGCTGTACGCC
GGTGGACGCCACACGCTTCAGAGCCGGCTAGAGGTGGGAGGCGTTGCCGACGCGGCGGCACGTGGCGAAGACGTG
TTGGACGACGACATCGTCATCTGGTCCGTCTTTGGTCTGACGCATAACCCTCGAGTCGAAGACTGGCCTGTCATG
CCCGTGGAGATGCTACAGGTGCACATTACGCCGTCAGATTTCTTCACTGAGAATCCGTCCATCGATGTTCCGTCC
AACGCGGACATTGGCTCACGGAACGTGACAGATGGGTGCTGCGAGGGCAAGGCGACGGAAAAGTCTCGGTTGTGA
Gene >Ophcf2|06915
ATGTCTCAGCCGCATCCCCTGTCCGGTCTCACGGCCGATGAGATCAATCGTGCCCGTGACGTCGTGCTGAGGCTA
CATCCGGGCACAGTCATCGACTTCCGCTCCATCTTCCTGCTGGAGCCGCCCAAGGCCGAGGTCGTTCCCTTTCTC
GCGCTCGAACATGCGGGAAAAGTCACGGCCAGCACGCCCCGGCCGGCGAGGCTGGCGCAGGCCTGGTACGACGTG
ATTGGCGGATCGCAGGCTGCCGAGTATCACGAGTCCGTCATCGATGTCGGCGCGGCCAAGCGTGTTGGCCACAAG
GTCGTTCCGACGGAGCATCACGCCGGACTGACCGTGTAAGTGGCTCACATCGCCCAAAGATCTCGGCCTTCTGCT
GATTGTGCGTAGCTTCGAGTTTAAAAAGCTGCTCGAATGCGTCAAGACGTCACCGCTCTTCCAGGAGAAGCTCAA
AGCCTTCCGGCTGCCCCCCGGCTTCGAGCTCGTCGTCGAGCCCTGGCCGTACGGAGCGCCAGACACGACCGACGG
CAACACCCGCCTGTTCCAGTGCCTCTGCTTCGCCCGCAACACCGCCAGCGGCAAAGACTCAAACTTTTACTCTTA
TCCCATCCCTCTGATTCCGGTCATGGACTACTGGAAGAACGAGGTCGTCCGCGTCGACGAACCGGCAACGGGCGG
TGGCTCAGATCCCCTCGTCGGACGCCCCAAGAACGCAGCCATCGTCGACCACTGCAAGCCGGCCGAATACGTGCC
AGAGCTTGTCCGCACGAGAACCGACGTGAAGCCCCTGACGGTGGTGCAGCCTCAGGGACCGAGCTTTACCGTCTC
AGACTCGAGCCTCATCGAGTGGCAGAAGTGGCGGATGCGAGTGTCTTTCAACCCGCGGGAGGGCGCCGTCCTTCA
CGATATCCGCTACGATGGCCGCGAAGTCCTCTACAGGCTGAGCATCAGCGACATGGCAAGTCAAGAGGAAGAATC
GAATCAAGCAGTGAACTAGGGCTAACGAAACTCATAGACGGTGCCATATGCCGATCCGCGGACGCCGTATCATCG
CAAGCAGGCCTTTGACTTTGGTGACGGTGGTCTTGGACACGCCGTAAACAACCTCAAACTCGGCTGCGACTGCTT
GGGCGTCATCAAGGTATCATTACTGAGAAGCCACGATTCTCGAGCCAGCTGCTGACTGTCTTTAGTACCTAGATG
GCGTCCTTACCACCGATGACGGCTCAGCCCAGACATCCAAGAACGTCATATGCATCCACGAGCAAGACAATGGCA
TCAACTGGAAGCACACGGACTGGCGGACGGGTCGCGCCACAGTAACTCGTCGCCGCGAACTGGTGGTGCAGTTCA
TCATCACTCTGGCCAACTACGAGTACATCTTCGCCTTCAAGTTCGACCAGGCAGCCGGCATCGTCGTCGAGGCTC
GCGCCACGGGCATAGTCTCCGTCGTCAACATAGACGAGGGCAAGACGGCTCCCTGGGGCAACGTCGTCGGCCCCG
GCGCCCTGGCGCAGAATCACCAACACATCTTCTGCGTCCGTGTTGATCCCGCCGTCGACGGGCACCGGAACACGC
TGGTGCAGGAGGATAGTCTCCCCGTAGCCATGAACGAACGCACCAGCCCGCACGGTAACTTTTACGAGGTACGCA
AGACGCCCATCGCCACGTCGTGCGGACTCGACCTCGCTCCCTTTAGCAACCGCGTCTTCAAGGTCCAGAACCAGG
CAAAGAGGAACCCGGTCAGCGGGAGACCGGTAGGTTACAAGATTACCGCGCCGCCGACGCAGCTCCTGCTGGCGG
ATCCCCGGAGCGTCCAGGCACAGCGGGCGCTGTTCGCCAAGCATCATCTCTGGGTTACCAAGTTCAAGGACGACG
AGCTGTACGCCGGTGGACGCCACACGCTTCAGAGCCGGCTAGAGGTGGGAGGCGTTGCCGACGCGGCGGCACGTG
GCGAAGACGTGTTGGACGACGACATCGTCATCTGGTCCGTCTTTGGTCTGACGCATAACCCTCGAGTCGAAGACT
GGCCTGTCATGTAAGCCGCCAGAACTATTGGAAGACGGATCGGGCTGACATTCGGTGGAATCTAGGCCCGTGGAG
ATGCTACAGGTGCACATTACGCCGTCAGATTTCTTCACTGAGAATCCGTCCATCGATGTTCCGTCCAACGCGGAC
ATTGGCTCACGGAACGTGACAGATGGGTGCTGCGAGGGCAAGGCGACGGAAAAGTCTCGGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail