Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06913
Gene name
Locationscaffold_08:1391302..1391815
Strand+
Gene length (bp)513
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04209 HgmA_C Homogentisate 1,2-dioxygenase C-terminal 3.6E-75 12 167

GO

GO Term Description Terminal node
GO:0006570 tyrosine metabolic process Yes
GO:0006559 L-phenylalanine catabolic process Yes
GO:0004411 homogentisate 1,2-dioxygenase activity Yes
GO:0046395 carboxylic acid catabolic process No
GO:0016054 organic acid catabolic process No
GO:0044281 small molecule metabolic process No
GO:0009063 cellular amino acid catabolic process No
GO:0003824 catalytic activity No
GO:0006520 cellular amino acid metabolic process No
GO:0044282 small molecule catabolic process No
GO:0016491 oxidoreductase activity No
GO:1901565 organonitrogen compound catabolic process No
GO:0009074 aromatic amino acid family catabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1902222 erythrose 4-phosphate/phosphoenolpyruvate family amino acid catabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009056 catabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:1901606 alpha-amino acid catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:1901575 organic substance catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:1902221 erythrose 4-phosphate/phosphoenolpyruvate family amino acid metabolic process No
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen No
GO:1901360 organic cyclic compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0006558 L-phenylalanine metabolic process No
GO:0003674 molecular_function No
GO:0009072 aromatic amino acid family metabolic process No
GO:0051213 dioxygenase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Peroxisomal targeting signal 0.4313 0.4391 0.2895 0.3121 0.014 0.0178 0.0531 0.2525 0.0402 0.3743

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7160
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06913 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1381
Ophiocordyceps subramaniannii Hirsu2|9803

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06913
MADYPYKYDLGRFCAMGSVSYDHPDPSIYTVLTGPSDHPGTAVADFVIFPPRWLVQEETFRPPWYHRNTMSEFMG
LIRGDYDAKAGGGFEPGGASLHNVMSAHGPDAATFEKGSSVELKPQKVGEGCMAFMFESSFMLGLTQWGLQTCSK
VQEEYNAESWSGLQPHFKRP*
Coding >Ophcf2|06913
ATGGCAGATTACCCGTATAAATACGACCTGGGCCGCTTCTGCGCCATGGGAAGCGTATCTTACGATCATCCCGAC
CCGTCAATATACACCGTCCTGACCGGCCCTTCGGACCATCCCGGTACAGCCGTCGCCGACTTCGTCATATTCCCT
CCACGATGGCTCGTCCAGGAAGAAACGTTCCGGCCCCCGTGGTACCACCGAAACACCATGTCCGAGTTCATGGGG
CTCATCCGCGGCGATTACGACGCCAAGGCAGGCGGAGGCTTCGAGCCCGGAGGCGCGAGCCTGCACAACGTCATG
AGCGCCCACGGACCTGACGCTGCGACCTTTGAAAAGGGCTCCAGCGTGGAGCTCAAGCCGCAAAAGGTCGGAGAG
GGCTGCATGGCTTTCATGTTTGAGAGCAGCTTCATGCTCGGTCTGACGCAATGGGGTTTGCAGACCTGCAGCAAG
GTCCAGGAAGAGTACAACGCAGAGAGCTGGTCGGGATTGCAGCCGCACTTCAAGCGGCCATGA
Transcript >Ophcf2|06913
ATGGCAGATTACCCGTATAAATACGACCTGGGCCGCTTCTGCGCCATGGGAAGCGTATCTTACGATCATCCCGAC
CCGTCAATATACACCGTCCTGACCGGCCCTTCGGACCATCCCGGTACAGCCGTCGCCGACTTCGTCATATTCCCT
CCACGATGGCTCGTCCAGGAAGAAACGTTCCGGCCCCCGTGGTACCACCGAAACACCATGTCCGAGTTCATGGGG
CTCATCCGCGGCGATTACGACGCCAAGGCAGGCGGAGGCTTCGAGCCCGGAGGCGCGAGCCTGCACAACGTCATG
AGCGCCCACGGACCTGACGCTGCGACCTTTGAAAAGGGCTCCAGCGTGGAGCTCAAGCCGCAAAAGGTCGGAGAG
GGCTGCATGGCTTTCATGTTTGAGAGCAGCTTCATGCTCGGTCTGACGCAATGGGGTTTGCAGACCTGCAGCAAG
GTCCAGGAAGAGTACAACGCAGAGAGCTGGTCGGGATTGCAGCCGCACTTCAAGCGGCCATGA
Gene >Ophcf2|06913
ATGGCAGATTACCCGTATAAATACGACCTGGGCCGCTTCTGCGCCATGGGAAGCGTATCTTACGATCATCCCGAC
CCGTCAATATACACCGTCCTGACCGGCCCTTCGGACCATCCCGGTACAGCCGTCGCCGACTTCGTCATATTCCCT
CCACGATGGCTCGTCCAGGAAGAAACGTTCCGGCCCCCGTGGTACCACCGAAACACCATGTCCGAGTTCATGGGG
CTCATCCGCGGCGATTACGACGCCAAGGCAGGCGGAGGCTTCGAGCCCGGAGGCGCGAGCCTGCACAACGTCATG
AGCGCCCACGGACCTGACGCTGCGACCTTTGAAAAGGGCTCCAGCGTGGAGCTCAAGCCGCAAAAGGTCGGAGAG
GGCTGCATGGCTTTCATGTTTGAGAGCAGCTTCATGCTCGGTCTGACGCAATGGGGTTTGCAGACCTGCAGCAAG
GTCCAGGAAGAGTACAACGCAGAGAGCTGGTCGGGATTGCAGCCGCACTTCAAGCGGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail