Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06901
Gene name
Locationscaffold_08:1362109..1365512
Strand+
Gene length (bp)3403
Transcript length (bp)2391
Coding sequence length (bp)2391
Protein length (aa) 797

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20511 PMI_typeI_cat Phosphomannose isomerase type I, catalytic domain 1.8E-54 5 151
PF07039 DUF1325 SGF29 tudor-like domain 6.7E-35 666 794
PF01238 PMI_typeI_C Phosphomannose isomerase type I C-terminal 1.9E-13 357 405
PF20512 PMI_typeI_hel Phosphomannose isomerase type I, helical insertion domain 2.8E-11 177 269

GO

GO Term Description Terminal node
GO:0004476 mannose-6-phosphate isomerase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008270 zinc ion binding Yes
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0016860 intramolecular oxidoreductase activity No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6563 0.6964 0.4388 0.0392 0.0961 0.0877 0.045 0.0275 0.1253 0.0085

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3286
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1019
Ophiocordyceps australis map64 (Brazil) OphauB2|7233
Ophiocordyceps camponoti-floridani Ophcf2|06901 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6962
Ophiocordyceps kimflemingae Ophio5|4267
Ophiocordyceps subramaniannii Hirsu2|6028

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06901
MQVPLFRLRCGLNSYEWGKKGSESAAARFAAATPSDSLSIESDKPYSELWMGSHPSNPSRDIDTGRTLSEIFADN
KALLSAGVAAGYGDRLPFLLKILSIDKALSIQAHPNKKLAEQLHARDPRNYPDDNHKPEMAIAITPFEGLCGFRP
LAEIAHFLASVPPLRSLVGDDNARSLAAEATTAHGGQDETGDQHRARMALRSAFGALMSSDADAVAREAPRLVDL
ARSEGDGFAAGGVSSTTGRDMAELVTRLHDQFGADIGLFVLFFLNFVRLQPGEALFLVADDIHAYVSGDIVECMA
ASDNVVRAGLTPKFKDVTTLVDMLTYRYAPIDQQKMVPTDYPYATLNRTAYTSGSAAVLYDPPIDEFAVVRTQLR
SVGAKVTMEAIDGPSIVICTAGRGSIAAGTTRLDVAEGGKTGDDKKRTAVRSSEKEGDTDTTSDTSSSSGIMSQR
NRSGRGSNRNNGNNAPGEEAQIWEACKVQIADIVTGVNNENDSLSELVKLDKEVGTMDPDRVPTDSIKQMEQLCR
KGVKFSEANISSLKTVTEQLKILRAVVVAKEQAESSASGTGKRAARDSAAAATAATASLYDFDGAGDSPVPSPVA
GGGAGGGAASGGVAGGGSSTSTRKQHGDRSSNRDSMPPKADSVEPQGPTASASGGNNSRSRVVFSKGDAVAFKPK
APSGEPSSDWILGEVAAVMGEGKSRRYKVLDIEPDDQSKQKEYRSSASSMIAITPESQAGTLRDWEAGKVVLALY
PNTTTFYKAEVHSMDEDGRVNLKFEGENDSTTLQQVERRFVIEFRA*
Coding >Ophcf2|06901
ATGCAGGTCCCCCTTTTCCGCCTCCGATGCGGTCTCAACTCGTACGAATGGGGTAAAAAGGGTTCTGAATCTGCT
GCTGCGCGCTTTGCTGCTGCCACGCCGTCGGATTCGCTGTCCATTGAGTCCGATAAGCCGTATTCCGAGCTATGG
ATGGGCTCGCATCCCTCGAATCCGTCTCGCGATATAGACACGGGCCGCACGCTTTCCGAAATATTCGCAGATAAC
AAGGCTCTTCTCTCTGCTGGCGTTGCTGCCGGCTACGGTGACCGTCTGCCCTTTCTTCTCAAGATTCTGTCCATC
GACAAGGCGCTATCGATCCAGGCACACCCCAACAAGAAGCTCGCTGAGCAGCTCCACGCCCGCGACCCGCGAAAC
TACCCAGACGACAACCACAAGCCCGAGATGGCCATTGCCATCACTCCTTTCGAGGGCTTATGCGGCTTCCGTCCG
CTCGCCGAGATCGCACACTTTCTCGCTTCGGTGCCGCCTTTACGCAGTCTCGTGGGTGATGACAACGCTCGCAGC
CTGGCTGCCGAGGCGACAACCGCCCACGGTGGGCAAGACGAAACCGGCGATCAGCACCGTGCTCGGATGGCACTG
CGCTCAGCGTTTGGTGCCCTCATGTCGTCTGATGCCGATGCCGTCGCGCGGGAGGCGCCTCGCCTTGTCGACTTG
GCTCGGTCCGAGGGCGACGGCTTTGCAGCCGGCGGTGTCTCCTCCACGACGGGTCGGGACATGGCGGAACTGGTG
ACACGCCTCCACGATCAGTTCGGGGCCGATATTGGCCTCTTCGTTCTCTTCTTTCTCAACTTTGTCAGGTTGCAG
CCTGGCGAGGCGCTGTTCCTAGTCGCCGACGACATCCACGCCTACGTCTCGGGCGACATTGTCGAGTGCATGGCC
GCCTCGGACAACGTGGTGCGGGCGGGTCTGACGCCCAAGTTCAAGGACGTGACGACGCTCGTCGACATGTTGACG
TACCGCTACGCGCCCATCGATCAGCAAAAGATGGTGCCGACCGACTACCCCTACGCGACTCTCAACCGCACCGCC
TACACCTCAGGCTCAGCCGCCGTCCTCTACGACCCTCCTATCGACGAGTTCGCCGTGGTCCGGACGCAGCTGCGC
AGCGTTGGCGCAAAGGTCACCATGGAGGCCATCGACGGTCCCAGCATCGTCATCTGCACCGCCGGACGGGGCTCC
ATCGCTGCGGGAACGACGCGGCTCGACGTGGCTGAGGGGGGAAAGACGGGCGACGATAAGAAACGCACCGCAGTC
CGCAGCAGCGAGAAAGAAGGCGACACCGACACGACAAGCGATACAAGTTCCAGTTCAGGCATCATGTCTCAGCGC
AACCGCAGCGGCCGCGGGTCCAACCGTAACAACGGCAACAATGCGCCCGGCGAGGAGGCGCAGATATGGGAAGCG
TGCAAGGTGCAGATTGCGGATATCGTCACGGGCGTCAACAACGAGAACGATAGCCTCTCCGAGCTCGTAAAGCTG
GATAAAGAGGTCGGCACAATGGATCCGGACAGGGTGCCTACGGACTCCATCAAGCAGATGGAGCAGCTGTGTCGT
AAAGGAGTCAAGTTTTCAGAGGCGAACATCTCGAGTCTCAAGACGGTGACGGAGCAGCTCAAGATCCTGCGGGCC
GTGGTGGTGGCCAAGGAGCAGGCCGAGTCGTCGGCGTCCGGGACGGGCAAGAGGGCGGCTCGGGACAGCGCGGCG
GCGGCGACGGCGGCGACGGCGTCGCTCTACGACTTTGACGGCGCGGGCGACTCGCCGGTGCCGAGCCCCGTGGCT
GGCGGCGGTGCGGGAGGAGGAGCAGCCTCGGGAGGAGTGGCGGGAGGAGGCTCGTCGACGTCCACGCGCAAGCAA
CACGGCGACCGGTCCAGCAACCGGGACAGCATGCCGCCCAAGGCCGACAGCGTGGAGCCCCAGGGACCGACGGCG
TCGGCAAGCGGCGGCAACAACAGCCGATCGCGCGTCGTCTTCTCCAAGGGCGACGCGGTGGCATTCAAGCCCAAG
GCGCCGAGCGGCGAGCCGTCATCGGACTGGATCCTGGGCGAGGTGGCGGCGGTGATGGGCGAGGGCAAGAGCCGA
CGCTACAAGGTTCTCGATATCGAACCCGACGACCAGAGCAAGCAGAAGGAGTACAGATCGAGCGCGAGCAGCATG
ATTGCCATTACGCCCGAGAGCCAAGCTGGGACGCTGCGCGACTGGGAGGCGGGAAAGGTGGTGCTCGCGCTGTAT
CCTAACACGACGACTTTTTACAAGGCCGAGGTGCACAGCATGGATGAGGACGGGCGGGTGAATCTCAAGTTTGAG
GGCGAGAACGACTCTACGACGTTGCAGCAGGTTGAGAGGCGCTTTGTTATTGAATTTCGGGCTTGA
Transcript >Ophcf2|06901
ATGCAGGTCCCCCTTTTCCGCCTCCGATGCGGTCTCAACTCGTACGAATGGGGTAAAAAGGGTTCTGAATCTGCT
GCTGCGCGCTTTGCTGCTGCCACGCCGTCGGATTCGCTGTCCATTGAGTCCGATAAGCCGTATTCCGAGCTATGG
ATGGGCTCGCATCCCTCGAATCCGTCTCGCGATATAGACACGGGCCGCACGCTTTCCGAAATATTCGCAGATAAC
AAGGCTCTTCTCTCTGCTGGCGTTGCTGCCGGCTACGGTGACCGTCTGCCCTTTCTTCTCAAGATTCTGTCCATC
GACAAGGCGCTATCGATCCAGGCACACCCCAACAAGAAGCTCGCTGAGCAGCTCCACGCCCGCGACCCGCGAAAC
TACCCAGACGACAACCACAAGCCCGAGATGGCCATTGCCATCACTCCTTTCGAGGGCTTATGCGGCTTCCGTCCG
CTCGCCGAGATCGCACACTTTCTCGCTTCGGTGCCGCCTTTACGCAGTCTCGTGGGTGATGACAACGCTCGCAGC
CTGGCTGCCGAGGCGACAACCGCCCACGGTGGGCAAGACGAAACCGGCGATCAGCACCGTGCTCGGATGGCACTG
CGCTCAGCGTTTGGTGCCCTCATGTCGTCTGATGCCGATGCCGTCGCGCGGGAGGCGCCTCGCCTTGTCGACTTG
GCTCGGTCCGAGGGCGACGGCTTTGCAGCCGGCGGTGTCTCCTCCACGACGGGTCGGGACATGGCGGAACTGGTG
ACACGCCTCCACGATCAGTTCGGGGCCGATATTGGCCTCTTCGTTCTCTTCTTTCTCAACTTTGTCAGGTTGCAG
CCTGGCGAGGCGCTGTTCCTAGTCGCCGACGACATCCACGCCTACGTCTCGGGCGACATTGTCGAGTGCATGGCC
GCCTCGGACAACGTGGTGCGGGCGGGTCTGACGCCCAAGTTCAAGGACGTGACGACGCTCGTCGACATGTTGACG
TACCGCTACGCGCCCATCGATCAGCAAAAGATGGTGCCGACCGACTACCCCTACGCGACTCTCAACCGCACCGCC
TACACCTCAGGCTCAGCCGCCGTCCTCTACGACCCTCCTATCGACGAGTTCGCCGTGGTCCGGACGCAGCTGCGC
AGCGTTGGCGCAAAGGTCACCATGGAGGCCATCGACGGTCCCAGCATCGTCATCTGCACCGCCGGACGGGGCTCC
ATCGCTGCGGGAACGACGCGGCTCGACGTGGCTGAGGGGGGAAAGACGGGCGACGATAAGAAACGCACCGCAGTC
CGCAGCAGCGAGAAAGAAGGCGACACCGACACGACAAGCGATACAAGTTCCAGTTCAGGCATCATGTCTCAGCGC
AACCGCAGCGGCCGCGGGTCCAACCGTAACAACGGCAACAATGCGCCCGGCGAGGAGGCGCAGATATGGGAAGCG
TGCAAGGTGCAGATTGCGGATATCGTCACGGGCGTCAACAACGAGAACGATAGCCTCTCCGAGCTCGTAAAGCTG
GATAAAGAGGTCGGCACAATGGATCCGGACAGGGTGCCTACGGACTCCATCAAGCAGATGGAGCAGCTGTGTCGT
AAAGGAGTCAAGTTTTCAGAGGCGAACATCTCGAGTCTCAAGACGGTGACGGAGCAGCTCAAGATCCTGCGGGCC
GTGGTGGTGGCCAAGGAGCAGGCCGAGTCGTCGGCGTCCGGGACGGGCAAGAGGGCGGCTCGGGACAGCGCGGCG
GCGGCGACGGCGGCGACGGCGTCGCTCTACGACTTTGACGGCGCGGGCGACTCGCCGGTGCCGAGCCCCGTGGCT
GGCGGCGGTGCGGGAGGAGGAGCAGCCTCGGGAGGAGTGGCGGGAGGAGGCTCGTCGACGTCCACGCGCAAGCAA
CACGGCGACCGGTCCAGCAACCGGGACAGCATGCCGCCCAAGGCCGACAGCGTGGAGCCCCAGGGACCGACGGCG
TCGGCAAGCGGCGGCAACAACAGCCGATCGCGCGTCGTCTTCTCCAAGGGCGACGCGGTGGCATTCAAGCCCAAG
GCGCCGAGCGGCGAGCCGTCATCGGACTGGATCCTGGGCGAGGTGGCGGCGGTGATGGGCGAGGGCAAGAGCCGA
CGCTACAAGGTTCTCGATATCGAACCCGACGACCAGAGCAAGCAGAAGGAGTACAGATCGAGCGCGAGCAGCATG
ATTGCCATTACGCCCGAGAGCCAAGCTGGGACGCTGCGCGACTGGGAGGCGGGAAAGGTGGTGCTCGCGCTGTAT
CCTAACACGACGACTTTTTACAAGGCCGAGGTGCACAGCATGGATGAGGACGGGCGGGTGAATCTCAAGTTTGAG
GGCGAGAACGACTCTACGACGTTGCAGCAGGTTGAGAGGCGCTTTGTTATTGAATTTCGGGCTTGA
Gene >Ophcf2|06901
ATGCAGGTCCCCCTTTTCCGCCTCCGATGCGGTCTCAACTCGTACGAATGGGGTAAAAAGGGTTCTGAATCTGCT
GCTGCGCGCTTTGCTGCTGCCACGCCGTCGGATTCGCTGTCCATTGAGTCCGATAAGCCGTATTCCGAGGTGGGG
TGGCTTCTTTGTTTCTTGTGTCTGCTGTTGGCGAGCTCACCGTTTGGACGCAGCTATGGATGGGCTCGCATCCCT
CGAATCCGTCTCGCGATATAGACACGGGCCGCACGCTTTCCGAAATATTCGCAGATAACAAGGCTCTTCTCTCTG
CTGGCGTTGCTGCCGGCTACGGTGACCGTCTGCCCTTTCTTCTCAAGATTCTGTCCATCGACAAGGCGCTATCGA
TCCAGGCACACCCCAACAAGAAGCTCGCTGAGCAGCTCCACGCCCGCGACCCGCGAAACTACCCAGACGACAACC
ACAAGCCCGAGATGGCCATTGCCATCACTCCTTTCGAGGGCTTATGCGGCTTCCGTCCGCTCGCCGAGATCGCAC
ACTTTCTCGCTTCGGTGCCGCCTTTACGCAGTCTCGTGGGTGATGACAACGCTCGCAGCCTGGCTGCCGAGGCGA
CAACCGCCCACGGTGGGCAAGACGAAACCGGCGATCAGCACCGTGCTCGGATGGCACTGCGCTCAGCGTTTGGTG
CCCTCATGTCGTCTGATGCCGATGCCGTCGCGCGGGAGGCGCCTCGCCTTGTCGACTTGGCTCGGTCCGAGGGCG
ACGGCTTTGCAGCCGGCGGTGTCTCCTCCACGACGGGTCGGGACATGGCGGAACTGGTGACACGCCTCCACGATC
AGTTCGGGGCCGATATTGGCCTCTTCGTTCTCTTCTTTCTCAACTTTGTCAGGTTGCAGCCTGGCGAGGCGCTGT
TCCTAGTCGCCGACGACATCCACGCCTACGTCTCGGGCGACATTGTCGAGTGCATGGCCGCCTCGGACAACGTGG
TGCGGGCGGGTCTGACGCCCAAGTTCAAGGACGTGACGACGCTCGTCGACATGTTGACGTACCGCTACGCGCCCA
TCGATCAGCAAAAGATGGTGCCGACCGACTACCCCTACGCGACTCTCAACCGCACCGCCTACACCTCAGGCTCAG
CCGCCGTCCTCTACGACCCTCCTATCGACGAGTTCGCCGTGGTCCGGACGCAGCTGCGCAGCGTTGGCGCAAAGG
TCACCATGGAGGCCATCGACGGTCCCAGCATCGTCATCTGCACCGCCGGACGGGGCTCCATCGCTGCGGGAACGA
CGCGGCTCGACGTGGCTGAGGGGTTTGTGTTTTTTGTTGGCTCGTCGGCTGAGCTGGTCATGGAGTCGACTGTGG
GTGATGGCGATGATGACGAAGGGTTTATCACGTTTCGGGCAATTTGTGAGCTGCCTCAGGGTCTCTAGGGGAAGG
ATTCGGGATAGAAAGAAGCATGCGGTATGATTCGGGGGAGGCAAGGTGCTATAGTAAAACCGAATCTTGTGCAGG
TGAATATGTTGTGTACAGCTGGCATGGATATTAATTGCCATGATCTCCCAGAGAATTTCCTTGATCGAAGCCCCG
AGACTCTCGTTGGATCCTCCTGGATCTGATAGAGCGATGATGCTACACCGTCTTTGATATCGCAAACTAGCACTG
TCCCTCACCGCCCGCGACGCGTCGATTCTGCCGCCACCAACTTTCGTTAGGACGGAACGTGCAACTCAAAAGAGG
CTCTTCAATGACGGCGACATTACCTGTCCATTGGCGACGTCTCCGATGCGGACAGCCTGGTCCCGCCCCAAGATA
ACCGGCCCTCTGCCGAAGCCGCTCTCAACAAACTCGGCGCTCTGCAGCTCGTCGCAGTAGAGCCTCGGTGTGCAT
AAGATGGGCTGAGCTCGTCGACGACGACCCTTTTTCTTCCTCAGACGGATCTTTTTACTCGGCGGACGAACGCTT
CGGTCTGCGCGTCGGCTTCTTCTTGCCTCTTGTCTGAGTCTTTTCGGCTTGGTCGTTGTTTCTATTTTTGTGGTG
TCAGACGGGCTCTGTTGAAGTTGAGATTCGTGCGTGATTCTTTTCTTTAATGTAATTTTCACATCCCCTTATTCC
TTATTCTGATTCTGTGTAGAGGATACGCATCATGGCTAACAAGCATAAGCGACTTGCAAGGGAGTTGGCCCTGCT
CTCGGAGGATCTCGGCCCTTACTACCACAGTCACGGCCTCCAGCCGCGCAGACAAGCCTCTGCCTAGAGCGGCAG
GGGAAAGACGGGCGACGATAAGAAACGCACCGCAGTCCGCAGCAGCGAGAAAGAAGGCGACACCGACACGACAAG
CGATACAAGTTCCAGTTCAGGCATCATGTCTCAGCGCAACCGCAGCGGCCGCGGGTCCAACCGTAACAACGGCAA
CAATGCGCCCGGCGAGGAGGCGCAGATATGGGAAGCGTGCAAGGTGCAGATTGCGGATATCGTCACGGGCGTCAA
CAACGAGAACGATAGCCTCTCCGAGCTCGTAAAGCTGGATAAAGAGGTCGGCACAATGGATCCGGACAGGGTGCC
TACGGACTCCATCAAGCAGATGGAGCAGCTGTGTCGTAAAGGAGTCAAGTTTTCAGAGGCGAACATCTCGAGTCT
CAAGACGGTGACGGAGCAGCTCAAGATCCTGCGGGCCGTGGTGGTGGCCAAGGAGCAGGCCGAGTCGTCGGCGTC
CGGGACGGGCAAGAGGGCGGCTCGGGACAGCGCGGCGGCGGCGACGGCGGCGACGGCGTCGCTCTACGACTTTGA
CGGCGCGGGCGACTCGCCGGTGCCGAGCCCCGTGGCTGGCGGCGGTGCGGGAGGAGGAGCAGCCTCGGGAGGAGT
GGCGGGAGGAGGCTCGTCGACGTCCACGCGCAAGCAACACGGCGACCGGTCCAGCAACCGGGACAGCATGCCGCC
CAAGGCCGACAGCGTGGAGCCCCAGGGACCGACGGCGTCGGCAAGCGGCGGCAACAACAGCCGATCGCGCGTCGT
CTTCTCCAAGGGCGACGCGGTGGCATTCAAGCCCAAGGCGCCGAGCGGCGAGCCGTCATCGGACTGGATCCTGGG
CGAGGTGGCGGCGGTGATGGGCGAGGGCAAGAGCCGACGCTACAAGGTTCTCGATATCGAACCCGACGACCAGAG
CAAGCAGAAGGAGTACAGATCGAGCGCGAGCAGCATGATTGCCATTACGCCCGAGAGCCAAGCTGGGACGCTGCG
CGACTGGGAGGCGGGAAAGGTGGTGCTCGCGCTGTATCCTAACACGACGACTTTTTACAAGGCCGAGGTGCACAG
CATGGATGAGGACGGGCGGGTGAATCTCAAGTTTGAGGGCGAGAACGACTCTACGACGTTGCAGCAGGTTGAGAG
GCGCTTTGTTATTGAATTTCGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail