Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06892
Gene name
Locationscaffold_08:1340184..1341299
Strand+
Gene length (bp)1115
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00925 GTP_cyclohydro2 GTP cyclohydrolase II 4.5E-61 104 315

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4505 0.7707 0.007 0.0292 0.4043 0.0549 0.0726 0.0843 0.1065 0.0875

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1015
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1901
Ophiocordyceps australis map64 (Brazil) OphauB2|2006
Ophiocordyceps camponoti-floridani Ophcf2|06892 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4542
Ophiocordyceps kimflemingae Ophio5|2469
Ophiocordyceps kimflemingae Ophio5|706
Ophiocordyceps subramaniannii Hirsu2|9132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06892
MSPDADEPSRLPPLYSPPTEPEPAAGQPVDRLDLPESTAESTSAPPPPPSLLSPAVTPPRTPGTQTPLTGGPRGV
PVDSSVPSGGCGTKRPRLLETLPEVQCIVRARIPTVAGTEMFLHLYNNSVDNKEHLAIVFGTHIRSRSLDAPRPG
ETEMDRMVRGAYTGRLYPGRTASAADDQSVSPPESPPLVRIHSECYTGETAWSARCDCGEQLDEAARLMGLPGNT
SGGIIIYLRQEGRGIGLGEKLKAYNLQDLGSDTVEANLLLRHPADARSYGLATAMLLDLGQTEIRLLTNNPDKIR
AVEGPNREIVVRERVAMVPLSWRGQGGFRSQEMEGYLKTKIEKMGHMLDMGH*
Coding >Ophcf2|06892
ATGTCGCCGGACGCCGACGAGCCCAGCCGGCTGCCGCCCTTGTACTCGCCGCCGACCGAGCCGGAGCCGGCCGCC
GGGCAGCCGGTAGACCGTCTCGACCTGCCGGAATCTACCGCCGAATCTACGTCCGCGCCGCCTCCGCCCCCATCG
CTGCTCTCCCCGGCCGTTACCCCTCCGCGGACTCCCGGTACGCAGACGCCGCTGACCGGCGGCCCGCGAGGAGTC
CCTGTCGATAGCTCCGTTCCCTCGGGCGGCTGCGGCACCAAGCGGCCACGATTGCTGGAGACGTTGCCCGAGGTC
CAATGCATTGTCCGCGCTCGGATCCCTACCGTCGCCGGCACCGAGATGTTTCTGCACCTGTACAACAACTCGGTC
GACAATAAGGAGCATCTCGCCATTGTTTTCGGCACGCATATCCGAAGTCGCAGCCTAGACGCCCCCCGCCCAGGC
GAGACCGAGATGGACCGAATGGTCCGCGGCGCCTACACCGGCCGGCTGTATCCTGGAAGGACTGCCAGCGCCGCC
GACGACCAATCCGTGTCGCCACCCGAGAGTCCGCCTTTGGTGCGAATACACTCCGAGTGCTACACGGGCGAGACG
GCCTGGTCGGCACGTTGCGACTGCGGCGAGCAGCTCGACGAGGCCGCCCGGCTGATGGGCCTGCCGGGAAACACA
AGCGGCGGCATCATCATCTATCTCCGCCAGGAGGGCCGGGGCATCGGTCTCGGCGAGAAGCTCAAGGCCTACAAC
CTGCAGGACCTGGGCTCTGATACAGTCGAGGCTAATCTGCTGCTACGCCATCCCGCCGACGCGAGGAGCTACGGG
CTGGCAACGGCGATGCTGCTCGATCTGGGCCAGACCGAGATCCGTCTTCTCACGAACAACCCCGACAAGATCCGG
GCCGTCGAGGGGCCCAACAGAGAGATTGTCGTCAGGGAGCGCGTGGCCATGGTCCCGCTGTCGTGGAGGGGCCAA
GGAGGCTTCCGCAGCCAAGAGATGGAGGGCTACCTCAAGACCAAGATTGAAAAGATGGGCCATATGCTAGATATG
GGCCACTGA
Transcript >Ophcf2|06892
ATGTCGCCGGACGCCGACGAGCCCAGCCGGCTGCCGCCCTTGTACTCGCCGCCGACCGAGCCGGAGCCGGCCGCC
GGGCAGCCGGTAGACCGTCTCGACCTGCCGGAATCTACCGCCGAATCTACGTCCGCGCCGCCTCCGCCCCCATCG
CTGCTCTCCCCGGCCGTTACCCCTCCGCGGACTCCCGGTACGCAGACGCCGCTGACCGGCGGCCCGCGAGGAGTC
CCTGTCGATAGCTCCGTTCCCTCGGGCGGCTGCGGCACCAAGCGGCCACGATTGCTGGAGACGTTGCCCGAGGTC
CAATGCATTGTCCGCGCTCGGATCCCTACCGTCGCCGGCACCGAGATGTTTCTGCACCTGTACAACAACTCGGTC
GACAATAAGGAGCATCTCGCCATTGTTTTCGGCACGCATATCCGAAGTCGCAGCCTAGACGCCCCCCGCCCAGGC
GAGACCGAGATGGACCGAATGGTCCGCGGCGCCTACACCGGCCGGCTGTATCCTGGAAGGACTGCCAGCGCCGCC
GACGACCAATCCGTGTCGCCACCCGAGAGTCCGCCTTTGGTGCGAATACACTCCGAGTGCTACACGGGCGAGACG
GCCTGGTCGGCACGTTGCGACTGCGGCGAGCAGCTCGACGAGGCCGCCCGGCTGATGGGCCTGCCGGGAAACACA
AGCGGCGGCATCATCATCTATCTCCGCCAGGAGGGCCGGGGCATCGGTCTCGGCGAGAAGCTCAAGGCCTACAAC
CTGCAGGACCTGGGCTCTGATACAGTCGAGGCTAATCTGCTGCTACGCCATCCCGCCGACGCGAGGAGCTACGGG
CTGGCAACGGCGATGCTGCTCGATCTGGGCCAGACCGAGATCCGTCTTCTCACGAACAACCCCGACAAGATCCGG
GCCGTCGAGGGGCCCAACAGAGAGATTGTCGTCAGGGAGCGCGTGGCCATGGTCCCGCTGTCGTGGAGGGGCCAA
GGAGGCTTCCGCAGCCAAGAGATGGAGGGCTACCTCAAGACCAAGATTGAAAAGATGGGCCATATGCTAGATATG
GGCCACTGA
Gene >Ophcf2|06892
ATGTCGCCGGACGCCGACGAGCCCAGCCGGCTGCCGCCCTTGTACTCGCCGCCGACCGAGCCGGAGCCGGCCGCC
GGGCAGCCGGTAGACCGTCTCGACCTGCCGGAATCTACCGCCGAATCTACGTCCGCGCCGCCTCCGCCCCCATCG
CTGCTCTCCCCGGCCGTTACCCCTCCGCGGACTCCCGGTACGCAGACGCCGCTGACCGGCGGCCCGCGAGGAGTC
CCTGTCGATAGCTCCGTTCCCTCGGGCGGCTGCGGCACCAAGCGGCCACGATTGCTGGAGACGTTGCCCGAGGTC
CAATGCATTGTCCGCGCTCGGATCCCTACCGTCGCCGGCACCGAGATGTTTCTGCACCTGTACAACAACTCGGTC
GACAATAAGGAGCATCTCGCCATTGTTTTCGGCACGCATATCCGAAGTCGCAGCCTAGACGCCCCCCGCCCAGGC
GAGACCGAGATGGACCGAATGGTCCGCGGCGCCTACACCGGCCGGCTGTATCCTGGAAGGACTGCCAGCGCCGCC
GACGACCAATCCGTGTCGCCACCCGAGAGTCCGCCTTTGGTGCGAATACACTCCGAGTGCTACACGGGCGAGACG
GCCTGGTCGGCACGTTGCGACTGCGGCGAGCAGCTCGACGAGGCCGCCCGGCTGATGGGCCTGCCGGGAAACACA
AGCGGCGGCATCATCATCTATCTCCGCCAGGAGGGCCGGGGCATCGGTCTCGGCGAGAAGCTCAAGGCCTACAAC
CTGCAGGACCTGGGCTCTGATACAGTCGAGGCTAATCTGCTGCTACGCCATCCCGCCGACGCGAGGAGCTACGGG
CTGGCAACGGCGATGCTGCTCGATCTGGGCCAGACCGAGATCCGTCTTCTCACGAACAACCCCGACAAGATCCGG
GCCGTCGAGGGGCCCAACAGAGAGATTGTCGTCAGGGAGCGCGTGGCCATGGTCCCGCTGTCGTGGAGGGGCCAA
GGAGGCTTCCGCAGCCAAGAGATGGAGGGCTACCTCAAGACCAAGGTGAGAAGCTCTATCCAATTACTTCGTTGG
TTTGCTGACCGGAGCGACCCTCGCAGATTGAAAAGATGGGCCATATGCTAGATATGGGCCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail