Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06890
Gene name
Locationscaffold_08:1334067..1335185
Strand-
Gene length (bp)1118
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17875 RPA43_OB RPA43 OB domain in RNA Pol I 2.4E-21 141 248

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.509 0.7979 0.0503 0.0139 0.2008 0.015 0.0613 0.0369 0.0657 0.0684

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup632
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6892
Ophiocordyceps australis map64 (Brazil) OphauB2|2019
Ophiocordyceps camponoti-floridani Ophcf2|06890 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4540
Ophiocordyceps kimflemingae Ophio5|2466
Ophiocordyceps subramaniannii Hirsu2|10219
Ophiocordyceps subramaniannii Hirsu2|9136

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06890
MLNRPLSAPATRTSSTRFPTFDAMEVDAETNDKGVYGPPDMPDEVRFPFFSQTVSLYLPLWPNGWETPVTSAQEQ
HFKPMLNNYVPYLHGVLLKYDKIALGARPGRRGAASSDDEPTTVQSRNEYGVGFGWVTADVELFMPRRGSWMEGT
INLQTEGHIGVVCFGKFNASIEAVRLPQTWKWVSEDHEFEQVTAAPDEYGVVQQLDSTGFWVDDKGARVQGKIRF
RIRNFDAGSSGESSYLSLEGTMLDEKREKELSTNEARTVSLPLSTNGGRRRVSDRRAVPASSLTCLASEQQPQQP
ATGDRTGATGAEASGGKDAVEDRFEAENVNLAAALELQSEIGDEEGGFESDD*
Coding >Ophcf2|06890
ATGCTCAACAGGCCGCTATCAGCGCCCGCGACGAGGACGAGCTCGACAAGGTTTCCGACCTTTGATGCCATGGAG
GTGGACGCCGAAACAAACGACAAGGGCGTTTACGGGCCCCCAGATATGCCCGACGAAGTGCGCTTCCCCTTCTTC
TCGCAGACCGTCTCCCTCTACCTACCCCTATGGCCCAACGGCTGGGAAACACCCGTCACGAGCGCGCAGGAACAA
CACTTCAAGCCCATGTTGAACAATTACGTCCCTTACCTACACGGCGTCCTCCTCAAGTACGACAAGATAGCCTTG
GGTGCCAGGCCCGGCCGACGCGGCGCGGCATCCAGCGACGACGAACCGACGACTGTCCAATCGCGCAACGAGTAC
GGCGTCGGCTTCGGCTGGGTGACTGCCGATGTAGAGCTCTTTATGCCCAGACGCGGGTCGTGGATGGAGGGCACC
ATCAACCTCCAGACCGAAGGCCACATCGGCGTCGTCTGCTTCGGCAAGTTCAACGCCTCCATCGAAGCAGTCCGG
CTCCCGCAAACCTGGAAATGGGTTTCGGAAGACCACGAGTTCGAGCAGGTCACCGCCGCGCCAGACGAGTACGGC
GTCGTGCAGCAGCTCGACAGCACGGGCTTCTGGGTAGATGACAAAGGCGCAAGGGTGCAGGGTAAAATCCGCTTT
CGCATCCGCAACTTCGACGCTGGCTCCAGCGGCGAGAGCAGCTATCTCAGTCTCGAGGGCACGATGCTCGACGAG
AAGAGGGAAAAGGAACTCTCTACGAACGAAGCCCGCACCGTCTCTCTTCCCCTCAGCACGAACGGCGGCCGGAGG
AGGGTCTCAGACCGTCGAGCCGTGCCAGCGTCCAGCCTGACGTGCCTGGCAAGCGAGCAGCAGCCGCAGCAACCC
GCGACCGGCGATCGAACGGGGGCCACCGGGGCGGAAGCGAGCGGAGGAAAGGACGCGGTAGAGGATCGGTTCGAG
GCTGAGAATGTGAATTTGGCGGCGGCGTTGGAGCTGCAGAGTGAGATTGGGGACGAGGAGGGCGGCTTTGAGAGC
GATGATTGA
Transcript >Ophcf2|06890
ATGCTCAACAGGCCGCTATCAGCGCCCGCGACGAGGACGAGCTCGACAAGGTTTCCGACCTTTGATGCCATGGAG
GTGGACGCCGAAACAAACGACAAGGGCGTTTACGGGCCCCCAGATATGCCCGACGAAGTGCGCTTCCCCTTCTTC
TCGCAGACCGTCTCCCTCTACCTACCCCTATGGCCCAACGGCTGGGAAACACCCGTCACGAGCGCGCAGGAACAA
CACTTCAAGCCCATGTTGAACAATTACGTCCCTTACCTACACGGCGTCCTCCTCAAGTACGACAAGATAGCCTTG
GGTGCCAGGCCCGGCCGACGCGGCGCGGCATCCAGCGACGACGAACCGACGACTGTCCAATCGCGCAACGAGTAC
GGCGTCGGCTTCGGCTGGGTGACTGCCGATGTAGAGCTCTTTATGCCCAGACGCGGGTCGTGGATGGAGGGCACC
ATCAACCTCCAGACCGAAGGCCACATCGGCGTCGTCTGCTTCGGCAAGTTCAACGCCTCCATCGAAGCAGTCCGG
CTCCCGCAAACCTGGAAATGGGTTTCGGAAGACCACGAGTTCGAGCAGGTCACCGCCGCGCCAGACGAGTACGGC
GTCGTGCAGCAGCTCGACAGCACGGGCTTCTGGGTAGATGACAAAGGCGCAAGGGTGCAGGGTAAAATCCGCTTT
CGCATCCGCAACTTCGACGCTGGCTCCAGCGGCGAGAGCAGCTATCTCAGTCTCGAGGGCACGATGCTCGACGAG
AAGAGGGAAAAGGAACTCTCTACGAACGAAGCCCGCACCGTCTCTCTTCCCCTCAGCACGAACGGCGGCCGGAGG
AGGGTCTCAGACCGTCGAGCCGTGCCAGCGTCCAGCCTGACGTGCCTGGCAAGCGAGCAGCAGCCGCAGCAACCC
GCGACCGGCGATCGAACGGGGGCCACCGGGGCGGAAGCGAGCGGAGGAAAGGACGCGGTAGAGGATCGGTTCGAG
GCTGAGAATGTGAATTTGGCGGCGGCGTTGGAGCTGCAGAGTGAGATTGGGGACGAGGAGGGCGGCTTTGAGAGC
GATGATTGA
Gene >Ophcf2|06890
ATGCTCAACAGGCCGCTATCAGCGCCCGCGACGAGGACGAGCTCGACAAGGTTTCCGAGTCGGTCGTTGTCCCAG
AGGCAACCATCCGACAACAACAGCCCGTCGCGGAATGGCCAGCCTTTGATGCCATGGAGGTGGACGCCGAAACAA
ACGACAAGGGCGTTTACGGGCCCCCAGATATGCCCGACGAAGTGCGCTTCCCCTTCTTCTCGCAGACCGTCTCCC
TCTACCTACCCCTATGGCCCAACGGCTGGGAAACACCCGTCACGAGCGCGCAGGAACAACACTTCAAGCCCATGT
TGAACAATTACGTCCCTTACCTACACGGCGTCCTCCTCAAGTACGACAAGATAGCCTTGGGTGCCAGGCCCGGCC
GACGCGGCGCGGCATCCAGCGACGACGAACCGACGACTGTCCAATCGCGCAACGAGTACGGCGTCGGCTTCGGCT
GGGTGACTGCCGATGTAGAGCTCTTTATGCCCAGACGCGGGTCGTGGATGGAGGGCACCATCAACCTCCAGACCG
AAGGCCACATCGGCGTCGTCTGCTTCGGCAAGTTCAACGCCTCCATCGAAGCAGTCCGGCTCCCGCAAACCTGGA
AATGGGTTTCGGAAGACCACGAGTTCGAGCAGGTCACCGCCGCGCCAGACGAGTACGGCGTCGTGCAGCAGCTCG
ACAGCACGGGCTTCTGGGTAGATGACAAAGGCGCAAGGGTGCAGGGTAAAATCCGCTTTCGCATCCGCAACTTCG
ACGCTGGCTCCAGCGGCGAGAGCAGCTATCTCAGTCTCGAGGGCACGATGCTCGACGAGAAGAGGGAAAAGGAAC
TCTCTACGAACGAAGCCCGCACCGTCTCTCTTCCCCTCAGCACGAACGGCGGCCGGAGGAGGGTCTCAGACCGTC
GAGCCGTGCCAGCGTCCAGCCTGACGTGCCTGGCAAGCGAGCAGCAGCCGCAGCAACCCGCGACCGGCGATCGAA
CGGGGGCCACCGGGGCGGAAGCGAGCGGAGGAAAGGACGCGGTAGAGGATCGGTTCGAGGCTGAGAATGTGAATT
TGGCGGCGGCGTTGGAGCTGCAGAGTGAGATTGGGGACGAGGAGGGCGGCTTTGAGAGCGATGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail