Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06882
Gene name
Locationscaffold_08:1314917..1316177
Strand+
Gene length (bp)1260
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07970 COPIIcoated_ERV Endoplasmic reticulum vesicle transporter 1.5E-34 177 338
PF13850 ERGIC_N Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 2.6E-22 22 108

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain 0.1571 0.1903 0.0455 0.1368 0.0558 0.0018 0.8537 0.7401 0.7312 0.0109

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4455
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1898
Ophiocordyceps australis map64 (Brazil) OphauB2|2009
Ophiocordyceps camponoti-floridani Ophcf2|06882 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5001
Ophiocordyceps kimflemingae Ophio5|4518
Ophiocordyceps subramaniannii Hirsu2|925

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06882
MNGFEKHNLDDDRFGAKGSIVSAFDAFPKSKPQYVTRTSGGGKWTVAMGLVSMVLLWSEMSRWWRGSESHAFAVE
KGVSQSMQINMDAVVRMKCDDLNINVQDAAGDRIRAGTRLRLDQTSWSQWINSKGIHQLGRDSDGRIITGAGWQS
LAHGEEGFGEEHVHDIVAAGKRRARWAKTPRVHGTPDSCRIYGSLELNKVQGDFHITARGHGYLEGGDHLDHDKF
NFSHIISELSYGPFYPSLVNPLDRTFNMAKANFHKFQYFLSVVPTVYTVGSSSIVTNQYAVTEQSIEINEMSIPG
IFFKYDIEPILLSVEETRDGILVFLVKLINVLSGVLVAGHWGYTLTEWVREVRGKRKRSMAGEGVLGNKDGYED*
Coding >Ophcf2|06882
ATGAACGGTTTCGAGAAGCACAACCTCGACGATGACCGCTTCGGCGCAAAGGGAAGCATCGTCAGTGCCTTTGAT
GCCTTTCCCAAGTCGAAACCGCAATATGTGACGAGGACGTCGGGCGGCGGCAAATGGACAGTGGCCATGGGCCTG
GTGTCGATGGTACTGCTATGGAGCGAGATGTCGCGCTGGTGGCGCGGGTCCGAGTCGCACGCCTTTGCCGTCGAA
AAGGGCGTCTCGCAGTCGATGCAGATCAACATGGATGCCGTCGTTCGTATGAAGTGCGACGATCTCAACATCAAC
GTCCAGGACGCCGCTGGCGATCGCATCCGCGCCGGCACGCGCCTACGCCTCGACCAGACGAGCTGGAGTCAGTGG
ATCAATTCAAAGGGTATCCATCAGCTCGGCAGAGACAGCGACGGACGTATAATCACCGGTGCCGGTTGGCAGAGC
CTGGCTCACGGAGAGGAGGGTTTCGGCGAGGAGCACGTCCACGACATCGTCGCCGCCGGGAAGCGGAGGGCGCGC
TGGGCCAAGACGCCTAGAGTGCACGGGACGCCCGACAGCTGCCGCATCTATGGCAGTCTGGAGCTCAACAAGGTC
CAGGGCGACTTTCACATCACGGCCCGCGGTCACGGCTATCTAGAGGGCGGCGACCATCTTGACCACGATAAGTTC
AACTTTTCTCACATCATCTCGGAGCTCTCTTACGGCCCCTTTTACCCTTCGCTCGTCAATCCGCTCGACCGTACC
TTTAACATGGCCAAGGCCAACTTCCACAAGTTTCAGTACTTCCTGTCCGTCGTGCCCACCGTCTACACAGTCGGA
TCGAGCTCCATCGTGACGAACCAGTACGCGGTGACGGAGCAGAGCATCGAGATTAACGAAATGTCCATCCCGGGC
ATCTTCTTCAAGTACGACATCGAGCCGATCCTGCTGTCGGTCGAGGAGACTCGCGACGGCATCCTCGTCTTTCTC
GTCAAGCTCATCAACGTCCTCTCCGGCGTCCTCGTCGCCGGTCACTGGGGCTATACACTCACCGAATGGGTGCGT
GAGGTGCGTGGCAAGCGCAAGCGGAGCATGGCCGGCGAGGGAGTCTTGGGCAACAAGGACGGTTACGAAGATTAG
Transcript >Ophcf2|06882
ATGAACGGTTTCGAGAAGCACAACCTCGACGATGACCGCTTCGGCGCAAAGGGAAGCATCGTCAGTGCCTTTGAT
GCCTTTCCCAAGTCGAAACCGCAATATGTGACGAGGACGTCGGGCGGCGGCAAATGGACAGTGGCCATGGGCCTG
GTGTCGATGGTACTGCTATGGAGCGAGATGTCGCGCTGGTGGCGCGGGTCCGAGTCGCACGCCTTTGCCGTCGAA
AAGGGCGTCTCGCAGTCGATGCAGATCAACATGGATGCCGTCGTTCGTATGAAGTGCGACGATCTCAACATCAAC
GTCCAGGACGCCGCTGGCGATCGCATCCGCGCCGGCACGCGCCTACGCCTCGACCAGACGAGCTGGAGTCAGTGG
ATCAATTCAAAGGGTATCCATCAGCTCGGCAGAGACAGCGACGGACGTATAATCACCGGTGCCGGTTGGCAGAGC
CTGGCTCACGGAGAGGAGGGTTTCGGCGAGGAGCACGTCCACGACATCGTCGCCGCCGGGAAGCGGAGGGCGCGC
TGGGCCAAGACGCCTAGAGTGCACGGGACGCCCGACAGCTGCCGCATCTATGGCAGTCTGGAGCTCAACAAGGTC
CAGGGCGACTTTCACATCACGGCCCGCGGTCACGGCTATCTAGAGGGCGGCGACCATCTTGACCACGATAAGTTC
AACTTTTCTCACATCATCTCGGAGCTCTCTTACGGCCCCTTTTACCCTTCGCTCGTCAATCCGCTCGACCGTACC
TTTAACATGGCCAAGGCCAACTTCCACAAGTTTCAGTACTTCCTGTCCGTCGTGCCCACCGTCTACACAGTCGGA
TCGAGCTCCATCGTGACGAACCAGTACGCGGTGACGGAGCAGAGCATCGAGATTAACGAAATGTCCATCCCGGGC
ATCTTCTTCAAGTACGACATCGAGCCGATCCTGCTGTCGGTCGAGGAGACTCGCGACGGCATCCTCGTCTTTCTC
GTCAAGCTCATCAACGTCCTCTCCGGCGTCCTCGTCGCCGGTCACTGGGGCTATACACTCACCGAATGGGTGCGT
GAGGTGCGTGGCAAGCGCAAGCGGAGCATGGCCGGCGAGGGAGTCTTGGGCAACAAGGACGGTTACGAAGATTAG
Gene >Ophcf2|06882
ATGAACGGTTTCGAGAAGCACAACCTCGACGATGACCGCTTCGGCGCAAAGGGAAGCATCGTCAGTGCCTTTGAT
GCCTTTCGTGAGCAGCCCTTACCCGTGTCTTGACGTCCGGTGATTCTCTTCTGACGACGAGCGGCGCGAGGCCAA
TTGCAGCCAAGTCGAAACCGCAATATGTGACGAGGACGTCGGGCGGCGGCAAATGGACAGTGGCCATGGGCCTGG
TGTCGATGGTACTGCTATGGAGCGAGATGTCGCGCTGGTGGCGCGGGTCCGAGTCGCACGCCTTTGCCGTCGAAA
AGGGCGTCTCGCAGTCGATGCAGATCAACATGGATGCCGTCGTTCGTATGAAGTGCGACGATCTCAACATCAACG
TCCAGGACGCCGCTGGCGATCGCATCCGCGCCGGCACGCGCCTACGCCTCGACCAGACGAGCTGGAGTCAGTGGA
TCAATTCAAAGGGTATCCATCAGCTCGGCAGAGACAGCGACGGACGTATAATCACCGGTGCCGGTTGGCAGAGCC
TGGCTCACGGAGAGGAGGGTTTCGGCGAGGAGCACGTCCACGACATCGTCGCCGCCGGGAAGCGGAGGGCGCGCT
GGGCCAAGACGCCTAGAGTGCACGGGACGCCCGACAGCTGCCGCATCTATGGCAGTCTGGAGCTCAACAAGGTCC
AGGGCGACTTTCACATCACGGCCCGCGGTCACGGCTATCTAGAGGGCGGCGACCATCTTGACCACGATAGTGCGT
TCTCACCTTGCTTGTGATGGAGCTGTTGCGTGCTGACTTGACTTTTGTCTCGAAGAGTTCAACTTTTCTCACATC
ATCTCGGAGCTCTCTTACGGCCCCTTTTACCCTTCGCTCGTCAATCCGCTCGACCGTACCTTTAACATGGCCAAG
GCCAACTTCCACAAGTTTCAGTACTTCCTGTCCGTCGTGCCCACCGTCTACACAGTCGGATCGAGCTCCATCGTG
ACGAACCAGTACGCGGTGACGGAGCAGAGCATCGAGATTAACGAAATGTCCATCCCGGGCATCTTCTTCAAGTAC
GACATCGAGCCGATCCTGCTGTCGGTCGAGGAGACTCGCGACGGCATCCTCGTCTTTCTCGTCAAGCTCATCAAC
GTCCTCTCCGGCGTCCTCGTCGCCGGTCACTGGGGCTATACACTCACCGAATGGGTGCGTGAGGTGCGTGGCAAG
CGCAAGCGGAGCATGGCCGGCGAGGGAGTCTTGGGCAACAAGGACGGTTACGAAGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail