Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06873
Gene name
Locationscaffold_08:1283017..1284366
Strand+
Gene length (bp)1349
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08426 ICE2 ICE2 3.1E-152 7 420

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 34 53 19
3 66 88 22
4 139 161 22
5 174 196 22
6 206 225 19
7 232 249 17
8 302 324 22
9 358 380 22
10 400 422 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 70.88 40.49 101.26
Alive In ants, during behavior modification 65.40 34.75 96.04
Dead In ants, recently dead 61.39 34.64 88.13

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.728463 no
Alive Dead 0.762704 no
Dead Fungus 0.486986 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06873
MWWLFSILLGFVFLLSIVLSIPVAFDVGGRDSGLAYSLSLFIYYLVYSAIRIATSDGSRVGRSVSAIVRLSQWIV
IPALMIWALGQFAVDAGSTHWVERTVGGVFRSKSTTWTGWLFGKDGVLEVVMLGTWDGALKYSGPVFQLLEGFCT
LLVIQAAGQITRWLVNRGRSDTWLILLLAFSGSVMASSVYFLWRVVQFPQIGNLDATLIGIAMTTAVFLCAYGIG
SGRGNPVESSLLFAYVVLCVYQIFTDYQPSDGTGQGDDQTAAQPDIPPLPPIIMASYSTLLHMVGSLPSALHSSL
ALLYAAFQTITPSVIISLTYRLLVLYSATRIIPSVRDLGARALMQEPDFDDSETANKVLGLLSYFSPSILVAVYT
SLLLQHFSTNGGPDGWTLRGGDVGGGTWRWVNVGLTMFLYGVELYLMDEQEHWKTD*
Coding >Ophcf2|06873
ATGTGGTGGCTATTCAGCATCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTTGCCTACAGCCTATCCCTCTTCATATACTACCTCGTCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCGTCGGACGGTCCGTGTCTGCCATCGTTCGCCTATCGCAATGGATCGTC
ATCCCGGCCCTGATGATATGGGCTCTTGGCCAGTTCGCCGTCGATGCGGGGAGCACTCACTGGGTTGAGAGGACC
GTCGGAGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGTAAGGACGGCGTGCTCGAGGTG
GTCATGCTGGGCACCTGGGACGGCGCACTCAAGTACTCGGGGCCAGTCTTTCAGCTGCTCGAAGGCTTCTGCACC
CTGCTGGTAATCCAGGCCGCCGGACAGATAACCCGCTGGCTCGTCAACAGGGGGAGGAGTGACACCTGGCTGATT
CTTCTCCTCGCCTTTTCCGGCTCCGTCATGGCCAGCTCCGTCTACTTCCTCTGGCGCGTTGTCCAGTTTCCGCAG
ATTGGCAATCTCGACGCAACCCTCATCGGCATCGCCATGACGACGGCCGTCTTCCTCTGTGCCTACGGAATCGGC
AGCGGGCGCGGCAACCCCGTGGAGAGCTCGCTGCTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACC
GACTACCAACCGTCGGACGGGACCGGACAGGGCGATGACCAGACGGCGGCGCAACCCGACATCCCGCCGCTGCCG
CCCATCATCATGGCCTCTTACTCGACGCTGCTGCACATGGTCGGCTCGCTGCCGTCGGCACTGCACTCGTCGCTG
GCGCTGCTGTACGCCGCGTTTCAGACCATTACGCCGTCCGTCATCATTTCTCTCACGTATCGGCTCCTGGTCTTG
TACTCGGCCACGCGCATCATCCCTTCCGTCAGGGACCTCGGAGCACGGGCGCTGATGCAAGAGCCGGACTTTGAT
GACTCGGAAACGGCGAACAAGGTGCTCGGCCTCTTGAGCTATTTCTCGCCCTCGATCCTGGTGGCCGTCTATACG
AGCCTGCTACTGCAGCATTTCTCGACAAACGGCGGGCCAGATGGATGGACGCTTCGGGGCGGCGACGTCGGAGGC
GGCACGTGGCGTTGGGTCAACGTCGGCCTGACCATGTTCCTCTACGGCGTCGAGCTTTACCTGATGGACGAGCAG
GAACACTGGAAGACGGATTAA
Transcript >Ophcf2|06873
ATGTGGTGGCTATTCAGCATCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTTGCCTACAGCCTATCCCTCTTCATATACTACCTCGTCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCGTCGGACGGTCCGTGTCTGCCATCGTTCGCCTATCGCAATGGATCGTC
ATCCCGGCCCTGATGATATGGGCTCTTGGCCAGTTCGCCGTCGATGCGGGGAGCACTCACTGGGTTGAGAGGACC
GTCGGAGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGTAAGGACGGCGTGCTCGAGGTG
GTCATGCTGGGCACCTGGGACGGCGCACTCAAGTACTCGGGGCCAGTCTTTCAGCTGCTCGAAGGCTTCTGCACC
CTGCTGGTAATCCAGGCCGCCGGACAGATAACCCGCTGGCTCGTCAACAGGGGGAGGAGTGACACCTGGCTGATT
CTTCTCCTCGCCTTTTCCGGCTCCGTCATGGCCAGCTCCGTCTACTTCCTCTGGCGCGTTGTCCAGTTTCCGCAG
ATTGGCAATCTCGACGCAACCCTCATCGGCATCGCCATGACGACGGCCGTCTTCCTCTGTGCCTACGGAATCGGC
AGCGGGCGCGGCAACCCCGTGGAGAGCTCGCTGCTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACC
GACTACCAACCGTCGGACGGGACCGGACAGGGCGATGACCAGACGGCGGCGCAACCCGACATCCCGCCGCTGCCG
CCCATCATCATGGCCTCTTACTCGACGCTGCTGCACATGGTCGGCTCGCTGCCGTCGGCACTGCACTCGTCGCTG
GCGCTGCTGTACGCCGCGTTTCAGACCATTACGCCGTCCGTCATCATTTCTCTCACGTATCGGCTCCTGGTCTTG
TACTCGGCCACGCGCATCATCCCTTCCGTCAGGGACCTCGGAGCACGGGCGCTGATGCAAGAGCCGGACTTTGAT
GACTCGGAAACGGCGAACAAGGTGCTCGGCCTCTTGAGCTATTTCTCGCCCTCGATCCTGGTGGCCGTCTATACG
AGCCTGCTACTGCAGCATTTCTCGACAAACGGCGGGCCAGATGGATGGACGCTTCGGGGCGGCGACGTCGGAGGC
GGCACGTGGCGTTGGGTCAACGTCGGCCTGACCATGTTCCTCTACGGCGTCGAGCTTTACCTGATGGACGAGCAG
GAACACTGGAAGACGGATTAA
Gene >Ophcf2|06873
ATGTGGTGGCTATTCAGCATCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTTGCCTACAGCCTATCCCTCTTCATATACTACCTCGTCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCGTCGGACGGTCCGTGTCTGCCATCGTTCGCCTATCGCAATGGATCGTC
ATCCCGGCCCTGATGATATGGGCTCTTGGCCAGTTCGCCGTCGATGCGGGGAGCACTCACTGGGTTGAGAGGACC
GTCGGAGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGTAAGGACGGCGTGCTCGAGGTG
GTCATGCTGGGCACCTGGGACGGCGCACTCAAGTACTCGGGGCCAGTCTTTCAGCTGCTCGAAGGCTTCTGCACC
CTGCTGGTAATCCAGGCCGCCGGACAGATAACCCGCTGGCTCGTCAACAGGGGGAGGAGTGACACCTGGCTGGTG
AGTCGACGACTTGTTCCCATAATTCGAAGCTGACGGAATCGCATCACCAGATTCTTCTCCTCGCCTTTTCCGGCT
CCGTCATGGCCAGCTCCGTCTACTTCCTCTGGCGCGTTGTCCAGTTTCCGCAGATTGGCAATCTCGACGCAACCC
TCATCGGCATCGCCATGACGACGGCCGTCTTCCTCTGTGCCTACGGAATCGGCAGCGGGCGCGGCAACCCCGTGG
AGAGCTCGCTGCTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACCGACTACCAACCGTCGGACGGGA
CCGGACAGGGCGATGACCAGACGGCGGCGCAACCCGACATCCCGCCGCTGCCGCCCATCATCATGGCCTCTTACT
CGACGCTGCTGCACATGGTCGGCTCGCTGCCGTCGGCACTGCACTCGTCGCTGGCGCTGCTGTACGCCGCGTTTC
AGACCATTACGCCGTCCGTCATCATTTCTCTCACGTATCGGCTCCTGGTCTTGTACTCGGCCACGCGCATCATCC
CTTCCGTCAGGGACCTCGGAGCACGGGCGCTGATGCAAGAGCCGGACTTTGATGACTCGGAAACGGCGAACAAGG
TGCTCGGCCTCTTGAGCTATTTCTCGCCCTCGATCCTGGTGGCCGTCTATACGAGCCTGCTACTGCAGCATTTCT
CGACAAACGGCGGGCCAGATGGATGGACGCTTCGGGGCGGCGACGTCGGAGGCGGCACGTGGCGTTGGGTCAACG
TCGGCCTGACCATGTTCCTCTACGGCGTCGAGCTTTACCTGATGGACGAGCAGGAACACTGGAAGACGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail