Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06873
Gene name
Locationscaffold_08:1283017..1284366
Strand+
Gene length (bp)1349
Transcript length (bp)1296
Coding sequence length (bp)1296
Protein length (aa) 432

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08426 ICE2 ICE2 3.1E-152 7 420

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 34 53 19
3 66 88 22
4 139 161 22
5 174 196 22
6 206 225 19
7 232 249 17
8 302 324 22
9 358 380 22
10 400 422 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06873
MWWLFSILLGFVFLLSIVLSIPVAFDVGGRDSGLAYSLSLFIYYLVYSAIRIATSDGSRVGRSVSAIVRLSQWIV
IPALMIWALGQFAVDAGSTHWVERTVGGVFRSKSTTWTGWLFGKDGVLEVVMLGTWDGALKYSGPVFQLLEGFCT
LLVIQAAGQITRWLVNRGRSDTWLILLLAFSGSVMASSVYFLWRVVQFPQIGNLDATLIGIAMTTAVFLCAYGIG
SGRGNPVESSLLFAYVVLCVYQIFTDYQPSDGTGQGDDQTAAQPDIPPLPPIIMASYSTLLHMVGSLPSALHSSL
ALLYAAFQTITPSVIISLTYRLLVLYSATRIIPSVRDLGARALMQEPDFDDSETANKVLGLLSYFSPSILVAVYT
SLLLQHFSTNGGPDGWTLRGGDVGGGTWRWVNVGLTMFLYGVELYLMDEQEHWKTD*
Coding >Ophcf2|06873
ATGTGGTGGCTATTCAGCATCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTTGCCTACAGCCTATCCCTCTTCATATACTACCTCGTCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCGTCGGACGGTCCGTGTCTGCCATCGTTCGCCTATCGCAATGGATCGTC
ATCCCGGCCCTGATGATATGGGCTCTTGGCCAGTTCGCCGTCGATGCGGGGAGCACTCACTGGGTTGAGAGGACC
GTCGGAGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGTAAGGACGGCGTGCTCGAGGTG
GTCATGCTGGGCACCTGGGACGGCGCACTCAAGTACTCGGGGCCAGTCTTTCAGCTGCTCGAAGGCTTCTGCACC
CTGCTGGTAATCCAGGCCGCCGGACAGATAACCCGCTGGCTCGTCAACAGGGGGAGGAGTGACACCTGGCTGATT
CTTCTCCTCGCCTTTTCCGGCTCCGTCATGGCCAGCTCCGTCTACTTCCTCTGGCGCGTTGTCCAGTTTCCGCAG
ATTGGCAATCTCGACGCAACCCTCATCGGCATCGCCATGACGACGGCCGTCTTCCTCTGTGCCTACGGAATCGGC
AGCGGGCGCGGCAACCCCGTGGAGAGCTCGCTGCTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACC
GACTACCAACCGTCGGACGGGACCGGACAGGGCGATGACCAGACGGCGGCGCAACCCGACATCCCGCCGCTGCCG
CCCATCATCATGGCCTCTTACTCGACGCTGCTGCACATGGTCGGCTCGCTGCCGTCGGCACTGCACTCGTCGCTG
GCGCTGCTGTACGCCGCGTTTCAGACCATTACGCCGTCCGTCATCATTTCTCTCACGTATCGGCTCCTGGTCTTG
TACTCGGCCACGCGCATCATCCCTTCCGTCAGGGACCTCGGAGCACGGGCGCTGATGCAAGAGCCGGACTTTGAT
GACTCGGAAACGGCGAACAAGGTGCTCGGCCTCTTGAGCTATTTCTCGCCCTCGATCCTGGTGGCCGTCTATACG
AGCCTGCTACTGCAGCATTTCTCGACAAACGGCGGGCCAGATGGATGGACGCTTCGGGGCGGCGACGTCGGAGGC
GGCACGTGGCGTTGGGTCAACGTCGGCCTGACCATGTTCCTCTACGGCGTCGAGCTTTACCTGATGGACGAGCAG
GAACACTGGAAGACGGATTAA
Transcript >Ophcf2|06873
ATGTGGTGGCTATTCAGCATCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTTGCCTACAGCCTATCCCTCTTCATATACTACCTCGTCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCGTCGGACGGTCCGTGTCTGCCATCGTTCGCCTATCGCAATGGATCGTC
ATCCCGGCCCTGATGATATGGGCTCTTGGCCAGTTCGCCGTCGATGCGGGGAGCACTCACTGGGTTGAGAGGACC
GTCGGAGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGTAAGGACGGCGTGCTCGAGGTG
GTCATGCTGGGCACCTGGGACGGCGCACTCAAGTACTCGGGGCCAGTCTTTCAGCTGCTCGAAGGCTTCTGCACC
CTGCTGGTAATCCAGGCCGCCGGACAGATAACCCGCTGGCTCGTCAACAGGGGGAGGAGTGACACCTGGCTGATT
CTTCTCCTCGCCTTTTCCGGCTCCGTCATGGCCAGCTCCGTCTACTTCCTCTGGCGCGTTGTCCAGTTTCCGCAG
ATTGGCAATCTCGACGCAACCCTCATCGGCATCGCCATGACGACGGCCGTCTTCCTCTGTGCCTACGGAATCGGC
AGCGGGCGCGGCAACCCCGTGGAGAGCTCGCTGCTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACC
GACTACCAACCGTCGGACGGGACCGGACAGGGCGATGACCAGACGGCGGCGCAACCCGACATCCCGCCGCTGCCG
CCCATCATCATGGCCTCTTACTCGACGCTGCTGCACATGGTCGGCTCGCTGCCGTCGGCACTGCACTCGTCGCTG
GCGCTGCTGTACGCCGCGTTTCAGACCATTACGCCGTCCGTCATCATTTCTCTCACGTATCGGCTCCTGGTCTTG
TACTCGGCCACGCGCATCATCCCTTCCGTCAGGGACCTCGGAGCACGGGCGCTGATGCAAGAGCCGGACTTTGAT
GACTCGGAAACGGCGAACAAGGTGCTCGGCCTCTTGAGCTATTTCTCGCCCTCGATCCTGGTGGCCGTCTATACG
AGCCTGCTACTGCAGCATTTCTCGACAAACGGCGGGCCAGATGGATGGACGCTTCGGGGCGGCGACGTCGGAGGC
GGCACGTGGCGTTGGGTCAACGTCGGCCTGACCATGTTCCTCTACGGCGTCGAGCTTTACCTGATGGACGAGCAG
GAACACTGGAAGACGGATTAA
Gene >Ophcf2|06873
ATGTGGTGGCTATTCAGCATCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTCTCCATACCCGTTGCCTTT
GACGTTGGCGGTCGCGACAGCGGGCTTGCCTACAGCCTATCCCTCTTCATATACTACCTCGTCTACTCGGCCATC
CGCATCGCCACCTCGGACGGGTCCCGCGTCGGACGGTCCGTGTCTGCCATCGTTCGCCTATCGCAATGGATCGTC
ATCCCGGCCCTGATGATATGGGCTCTTGGCCAGTTCGCCGTCGATGCGGGGAGCACTCACTGGGTTGAGAGGACC
GTCGGAGGCGTCTTTCGTTCCAAGAGCACCACCTGGACCGGCTGGCTGTTTGGTAAGGACGGCGTGCTCGAGGTG
GTCATGCTGGGCACCTGGGACGGCGCACTCAAGTACTCGGGGCCAGTCTTTCAGCTGCTCGAAGGCTTCTGCACC
CTGCTGGTAATCCAGGCCGCCGGACAGATAACCCGCTGGCTCGTCAACAGGGGGAGGAGTGACACCTGGCTGGTG
AGTCGACGACTTGTTCCCATAATTCGAAGCTGACGGAATCGCATCACCAGATTCTTCTCCTCGCCTTTTCCGGCT
CCGTCATGGCCAGCTCCGTCTACTTCCTCTGGCGCGTTGTCCAGTTTCCGCAGATTGGCAATCTCGACGCAACCC
TCATCGGCATCGCCATGACGACGGCCGTCTTCCTCTGTGCCTACGGAATCGGCAGCGGGCGCGGCAACCCCGTGG
AGAGCTCGCTGCTGTTTGCCTACGTCGTCCTCTGCGTCTACCAAATCTTCACCGACTACCAACCGTCGGACGGGA
CCGGACAGGGCGATGACCAGACGGCGGCGCAACCCGACATCCCGCCGCTGCCGCCCATCATCATGGCCTCTTACT
CGACGCTGCTGCACATGGTCGGCTCGCTGCCGTCGGCACTGCACTCGTCGCTGGCGCTGCTGTACGCCGCGTTTC
AGACCATTACGCCGTCCGTCATCATTTCTCTCACGTATCGGCTCCTGGTCTTGTACTCGGCCACGCGCATCATCC
CTTCCGTCAGGGACCTCGGAGCACGGGCGCTGATGCAAGAGCCGGACTTTGATGACTCGGAAACGGCGAACAAGG
TGCTCGGCCTCTTGAGCTATTTCTCGCCCTCGATCCTGGTGGCCGTCTATACGAGCCTGCTACTGCAGCATTTCT
CGACAAACGGCGGGCCAGATGGATGGACGCTTCGGGGCGGCGACGTCGGAGGCGGCACGTGGCGTTGGGTCAACG
TCGGCCTGACCATGTTCCTCTACGGCGTCGAGCTTTACCTGATGGACGAGCAGGAACACTGGAAGACGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail