Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06872
Gene name
Locationscaffold_08:1278613..1280380
Strand-
Gene length (bp)1767
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 4.1E-27 117 523

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 125 147 22
2 152 174 22
3 195 217 22
4 232 251 19
5 263 285 22
6 313 335 22
7 347 369 22
8 393 415 22
9 427 449 22
10 459 481 22
11 501 523 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06872
MNLQPPAPEKPLGPTSARELDRPVSSSSIPDDRPSPPPLSPPRRRRRRAMPYLGGAGVTIGPRITAVPAWVKDES
VATETAAGVGASSDDDTEAASSNAIVNRQLASETGRSIQYRTCSWQKTAALLFSEYICLAIMSFPWSYSYLGLVP
GLILTIVIAAVVLYTSLVLWELCLRHPEVRDVCDLGQMLFWEKPWAWWATAIMFVLNNTFIQGLHVLVGAEYLNT
MTETHAVTGCRTVQFSLVVTFICWVASLPRTFSMLSKLGTAAAFFTFVAVILATVFAAVQPRPAGFDPVKGLPLW
TALPVKSTTFVQGMAAFLNISYTFIGQITLPSFIAEMRDPREFPKSLWACTIAEIITFSIVGAVIYVYTGNQYVK
SPAFGSLEDLYKKVSFSFMIPTIIFLGCLYASVTARFVFFRVFRGSRHLNDHTLVGWGSWGGILLCTWIMAFLIS
QLIPFFSSLLAVMSSLFDSWFGFIFWGVAYFRMRDADLAAGFRRRPLTDMLSMALNLVIILTGFFFLTVGTYASV
QGIIDSFRSGEVGGVFSCKSNGV*
Coding >Ophcf2|06872
ATGAATCTACAGCCTCCCGCCCCGGAAAAGCCTCTCGGTCCGACATCCGCCCGGGAACTCGATCGCCCCGTATCC
TCATCTTCCATCCCCGATGACCGACCTTCTCCGCCTCCGCTCTCGCCTCCCCGTCGGCGCCGTCGCCGCGCGATG
CCCTACCTCGGAGGCGCGGGCGTCACCATCGGGCCTCGTATCACTGCTGTTCCGGCGTGGGTCAAGGACGAGAGC
GTGGCGACGGAGACGGCTGCTGGCGTGGGCGCTTCTTCGGATGATGATACGGAAGCGGCTTCGAGCAACGCCATT
GTCAACCGGCAGCTCGCTTCGGAGACGGGCAGGTCGATTCAATACCGGACTTGCAGCTGGCAGAAGACGGCGGCG
CTGCTGTTTAGCGAGTACATTTGCCTGGCCATCATGAGCTTTCCCTGGTCGTACAGCTATCTCGGCTTGGTCCCG
GGACTGATCCTCACCATTGTCATTGCTGCTGTGGTGCTTTACACCAGCCTCGTGCTCTGGGAGCTCTGTCTGCGG
CATCCAGAGGTGCGAGACGTCTGCGATCTCGGACAGATGCTCTTCTGGGAGAAGCCATGGGCCTGGTGGGCAACT
GCCATCATGTTTGTCCTCAACAACACCTTTATCCAGGGTCTACACGTCCTCGTCGGAGCAGAGTATCTCAACACC
ATGACGGAGACGCACGCCGTCACCGGCTGTCGAACCGTTCAGTTCTCTCTGGTTGTTACCTTTATCTGCTGGGTG
GCCTCGCTTCCCCGTACCTTTAGCATGCTCTCCAAGCTCGGAACGGCCGCCGCCTTCTTCACCTTTGTCGCCGTC
ATTCTCGCCACAGTCTTTGCTGCCGTTCAGCCCCGGCCTGCCGGCTTCGATCCCGTCAAGGGATTGCCATTGTGG
ACGGCGCTTCCGGTCAAGAGCACCACCTTTGTCCAGGGCATGGCCGCCTTTCTCAACATCAGCTACACCTTTATC
GGACAGATTACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCGCGAGAGTTCCCCAAGTCGCTCTGGGCCTGC
ACCATTGCCGAGATCATCACCTTTAGCATCGTCGGCGCCGTCATCTACGTCTACACGGGCAATCAGTATGTCAAG
TCGCCGGCCTTTGGCTCGCTCGAAGATCTGTATAAAAAGGTGTCGTTTTCATTCATGATTCCCACAATCATCTTC
CTCGGCTGTCTGTACGCGTCGGTGACGGCCCGCTTCGTCTTCTTCCGCGTCTTCCGCGGCTCGCGTCATCTCAAC
GACCATACCTTGGTCGGCTGGGGAAGTTGGGGCGGCATCCTGCTGTGCACCTGGATCATGGCCTTTTTGATATCC
CAGCTAATTCCCTTTTTCTCTTCCCTACTGGCCGTCATGTCCTCTCTATTCGACAGCTGGTTCGGCTTCATCTTC
TGGGGCGTCGCCTACTTCCGCATGCGAGACGCCGATCTCGCCGCCGGGTTCCGCCGCCGGCCCCTGACCGATATG
CTATCCATGGCCCTCAACCTCGTCATCATCCTCACCGGCTTCTTCTTCCTCACCGTCGGCACCTACGCCAGCGTT
CAGGGAATCATCGACTCCTTCCGCTCCGGCGAGGTCGGCGGCGTCTTCTCCTGCAAGAGCAATGGCGTCTGA
Transcript >Ophcf2|06872
ATGAATCTACAGCCTCCCGCCCCGGAAAAGCCTCTCGGTCCGACATCCGCCCGGGAACTCGATCGCCCCGTATCC
TCATCTTCCATCCCCGATGACCGACCTTCTCCGCCTCCGCTCTCGCCTCCCCGTCGGCGCCGTCGCCGCGCGATG
CCCTACCTCGGAGGCGCGGGCGTCACCATCGGGCCTCGTATCACTGCTGTTCCGGCGTGGGTCAAGGACGAGAGC
GTGGCGACGGAGACGGCTGCTGGCGTGGGCGCTTCTTCGGATGATGATACGGAAGCGGCTTCGAGCAACGCCATT
GTCAACCGGCAGCTCGCTTCGGAGACGGGCAGGTCGATTCAATACCGGACTTGCAGCTGGCAGAAGACGGCGGCG
CTGCTGTTTAGCGAGTACATTTGCCTGGCCATCATGAGCTTTCCCTGGTCGTACAGCTATCTCGGCTTGGTCCCG
GGACTGATCCTCACCATTGTCATTGCTGCTGTGGTGCTTTACACCAGCCTCGTGCTCTGGGAGCTCTGTCTGCGG
CATCCAGAGGTGCGAGACGTCTGCGATCTCGGACAGATGCTCTTCTGGGAGAAGCCATGGGCCTGGTGGGCAACT
GCCATCATGTTTGTCCTCAACAACACCTTTATCCAGGGTCTACACGTCCTCGTCGGAGCAGAGTATCTCAACACC
ATGACGGAGACGCACGCCGTCACCGGCTGTCGAACCGTTCAGTTCTCTCTGGTTGTTACCTTTATCTGCTGGGTG
GCCTCGCTTCCCCGTACCTTTAGCATGCTCTCCAAGCTCGGAACGGCCGCCGCCTTCTTCACCTTTGTCGCCGTC
ATTCTCGCCACAGTCTTTGCTGCCGTTCAGCCCCGGCCTGCCGGCTTCGATCCCGTCAAGGGATTGCCATTGTGG
ACGGCGCTTCCGGTCAAGAGCACCACCTTTGTCCAGGGCATGGCCGCCTTTCTCAACATCAGCTACACCTTTATC
GGACAGATTACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCGCGAGAGTTCCCCAAGTCGCTCTGGGCCTGC
ACCATTGCCGAGATCATCACCTTTAGCATCGTCGGCGCCGTCATCTACGTCTACACGGGCAATCAGTATGTCAAG
TCGCCGGCCTTTGGCTCGCTCGAAGATCTGTATAAAAAGGTGTCGTTTTCATTCATGATTCCCACAATCATCTTC
CTCGGCTGTCTGTACGCGTCGGTGACGGCCCGCTTCGTCTTCTTCCGCGTCTTCCGCGGCTCGCGTCATCTCAAC
GACCATACCTTGGTCGGCTGGGGAAGTTGGGGCGGCATCCTGCTGTGCACCTGGATCATGGCCTTTTTGATATCC
CAGCTAATTCCCTTTTTCTCTTCCCTACTGGCCGTCATGTCCTCTCTATTCGACAGCTGGTTCGGCTTCATCTTC
TGGGGCGTCGCCTACTTCCGCATGCGAGACGCCGATCTCGCCGCCGGGTTCCGCCGCCGGCCCCTGACCGATATG
CTATCCATGGCCCTCAACCTCGTCATCATCCTCACCGGCTTCTTCTTCCTCACCGTCGGCACCTACGCCAGCGTT
CAGGGAATCATCGACTCCTTCCGCTCCGGCGAGGTCGGCGGCGTCTTCTCCTGCAAGAGCAATGGCGTCTGA
Gene >Ophcf2|06872
ATGAATCTACAGCCTCCCGCCCCGGAAAAGCCTCTCGGTCCGACATCCGCCCGGGAACTCGATCGCCCCGTATCC
TCATCTTCCATCCCCGATGACCGACCTTCTCCGCCTCCGCTCTCGCCTCCCCGTCGGCGCCGTCGCCGCGCGATG
CCCTACCTCGGAGGCGCGGGCGTCACCATCGGGCCTCGTATCACTGCTGTTCCGGCGTGGGTCAAGGACGAGAGC
GTGGCGACGGAGACGGCTGCTGGCGTGGGCGCTTCTTCGGATGATGATACGGAAGCGGCTTCGAGCAACGCCATT
GTCAACCGGCAGCTCGCTTCGGAGACGGGCAGGTCGATTCAATACCGGACTTGCAGCTGGCAGAAGACGGCGGCG
CTGCTGTTTAGCGAGTACATTTGCCTGGCCATCATGAGCTTTCCCTGGTCGTACAGCTATCTCGGCTTGGTCCCG
GGACTGATCCTCACCATTGTCATTGCTGCTGTGGTGCTTTACACCAGCCTCGTGCTCTGGGAGCTCTGTCTGCGG
CATCCAGAGGTGCGAGACGTCTGCGATCTCGGACAGATGCTCTTCTGGGAGAAGCCATGGGCCTGGTGGGCAACT
GCCATCATGTTTGTCCTCAACAACACCTTTATCCAGGGTCTACACGTCCTCGTCGGAGCAGAGTATCTCAACACC
ATGACGGAGACGCACGCCGTCACCGGCTGTCGAACCGTTCAGTTCTCTCTGGTTGTTACCTTTATCTGCTGGGTG
GCCTCGCTTCCCCGTACCTTTAGCATGCTCTCCAAGCTCGGAACGGCCGCCGCCTTCTTCACCTTTGTCGCCGTC
ATTCTCGCCACAGTCTTTGCTGCCGTTCAGCCCCGGCCTGCCGGCTTCGATCCCGTCAAGGGATTGCCATTGTGG
ACGGCGCTTCCGGTCAAGAGCACCACCTTTGTCCAGGGCATGGCCGCCTTTCTCAACATCAGCTACACCTTTATC
GGACAGATTACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCGCGGTAAATAAGTGACGCCGTCTTGTCTTCA
CCATCAACCTGCTGACTATCCGCATCTCCAGAGAGTTCCCCAAGTCGCTCTGGGCCTGCACCATTGCCGAGATCA
TCACCTTTAGCATCGTCGGCGCCGTCATCTACGTCTACACGGGCAATCAGTATGTCAAGTCGCCGGCCTTTGGCT
CGCTCGAAGATCTGTATAAAAAGGTGTCGTTTTCATTCATGATTCCCACAATCATCTTCCTCGGCTGTCTGTACG
CGTCGGTGACGGCCCGCTTCGTCTTCTTCCGCGTCTTCCGCGGCTCGCGTCATCTCAACGACCATACCTTGGTCG
GCTGGGGAAGTTGGGGCGGCATCCTGCTGTGCACCTGGATCATGGCCTTTTTGATATCCCAGCTAATTCCCTTTT
TCTCTTCCCGTGAGTATCTGTCATCCATCCATCTCTTCAGAATCTCCCGCAACTAACTAAGACGGTATAGTACTG
GCCGTCATGTCCTCTCTATTCGACAGCTGGTTCGGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGCGAGAC
GCCGATCTCGCCGCCGGGTTCCGCCGCCGGCCCCTGACCGATATGCTATCCATGGCCCTCAACCTCGTCATCATC
CTCACCGGCTTCTTCTTCCTCACCGTCGGCACCTACGCCAGCGTTCAGGGAATCATCGACTCCTTCCGCTCCGGC
GAGGTCGGCGGCGTCTTCTCCTGCAAGAGCAATGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail