Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06871
Gene name
Locationscaffold_08:1276758..1277896
Strand-
Gene length (bp)1138
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 1.7E-25 77 312
PF08557 Lipid_DES Sphingolipid Delta4-desaturase (DES) 2.3E-18 13 47

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 50 67 17
2 72 94 22
3 107 129 22
4 155 177 22
5 190 209 19
6 213 235 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06871
MTIPPKAAPRPDHDFIWTYTEEPHRTRRLAIIKAHPEVTKLCGPEPLTKYVVALVVALQVTTAWALSSGDFWTMR
FWLVAYVVGATANQNLFLAIHEISHNLAFRSPLANRVFAVFANLPIGVPYSASFRPYHLTHHKSLGVDGIDTDLP
TALEAVILDSLLGKAFFCTFQIFFYAIRPMTVYRVPFTKLHVFNVVIQILFDLAIIRFLSPTALAYLILSSFLAG
SLHPLAAHFIAEHYVYDLPQHLTRQPSSTSTSTSTSPDTPVPETFSYYGPLNWLTYNVGLHNEHHDFPAIPWSRL
PTLRRIADDFYRDLPCHTSWSYALWRFIWDDGVGMTCRVKREKAKKGRWAESEIQA*
Coding >Ophcf2|06871
ATGACCATCCCCCCCAAAGCAGCCCCCCGCCCAGACCACGACTTCATCTGGACCTACACCGAAGAACCCCACCGA
ACCCGCCGCCTCGCCATCATAAAAGCCCACCCGGAAGTAACGAAGCTATGCGGTCCGGAGCCCCTGACCAAGTAC
GTCGTCGCCCTGGTGGTGGCCCTACAAGTGACGACGGCGTGGGCCCTCTCCAGCGGCGACTTCTGGACCATGCGC
TTCTGGCTGGTTGCCTACGTCGTCGGCGCGACGGCCAACCAGAATCTCTTCCTGGCCATACATGAGATTTCGCAT
AATTTGGCCTTTCGTTCTCCGCTGGCGAATAGGGTCTTTGCCGTCTTTGCAAATTTACCCATCGGCGTACCCTAC
AGCGCTTCCTTTCGACCATATCATCTCACCCATCACAAGTCCTTGGGCGTAGATGGCATCGACACCGATCTGCCC
ACCGCCCTCGAAGCCGTCATCCTCGACTCCCTCCTGGGAAAAGCCTTCTTCTGCACCTTTCAGATCTTCTTCTAC
GCCATTCGCCCCATGACAGTCTACCGCGTCCCCTTTACAAAACTACACGTCTTCAACGTCGTGATCCAAATCCTC
TTCGACCTCGCCATCATCCGATTCCTCTCCCCCACGGCACTAGCATATCTAATCCTCTCCTCCTTTCTGGCCGGA
AGCCTCCACCCCCTCGCAGCGCATTTCATAGCAGAGCACTACGTCTACGACCTCCCCCAGCATCTAACCCGACAA
CCCTCCTCCACCTCCACCTCCACCTCCACCTCCCCCGACACCCCCGTCCCAGAAACATTCTCCTACTACGGCCCC
CTAAACTGGCTAACCTACAACGTCGGCCTTCACAACGAACACCACGACTTCCCCGCCATCCCCTGGTCCCGCCTC
CCGACGCTGCGCAGAATCGCAGACGACTTCTACCGCGACCTCCCGTGTCATACCAGCTGGTCATACGCGCTTTGG
CGCTTCATCTGGGATGATGGTGTGGGCATGACTTGTAGGGTTAAGAGGGAGAAGGCGAAGAAGGGGAGGTGGGCT
GAGTCTGAGATTCAGGCTTGA
Transcript >Ophcf2|06871
ATGACCATCCCCCCCAAAGCAGCCCCCCGCCCAGACCACGACTTCATCTGGACCTACACCGAAGAACCCCACCGA
ACCCGCCGCCTCGCCATCATAAAAGCCCACCCGGAAGTAACGAAGCTATGCGGTCCGGAGCCCCTGACCAAGTAC
GTCGTCGCCCTGGTGGTGGCCCTACAAGTGACGACGGCGTGGGCCCTCTCCAGCGGCGACTTCTGGACCATGCGC
TTCTGGCTGGTTGCCTACGTCGTCGGCGCGACGGCCAACCAGAATCTCTTCCTGGCCATACATGAGATTTCGCAT
AATTTGGCCTTTCGTTCTCCGCTGGCGAATAGGGTCTTTGCCGTCTTTGCAAATTTACCCATCGGCGTACCCTAC
AGCGCTTCCTTTCGACCATATCATCTCACCCATCACAAGTCCTTGGGCGTAGATGGCATCGACACCGATCTGCCC
ACCGCCCTCGAAGCCGTCATCCTCGACTCCCTCCTGGGAAAAGCCTTCTTCTGCACCTTTCAGATCTTCTTCTAC
GCCATTCGCCCCATGACAGTCTACCGCGTCCCCTTTACAAAACTACACGTCTTCAACGTCGTGATCCAAATCCTC
TTCGACCTCGCCATCATCCGATTCCTCTCCCCCACGGCACTAGCATATCTAATCCTCTCCTCCTTTCTGGCCGGA
AGCCTCCACCCCCTCGCAGCGCATTTCATAGCAGAGCACTACGTCTACGACCTCCCCCAGCATCTAACCCGACAA
CCCTCCTCCACCTCCACCTCCACCTCCACCTCCCCCGACACCCCCGTCCCAGAAACATTCTCCTACTACGGCCCC
CTAAACTGGCTAACCTACAACGTCGGCCTTCACAACGAACACCACGACTTCCCCGCCATCCCCTGGTCCCGCCTC
CCGACGCTGCGCAGAATCGCAGACGACTTCTACCGCGACCTCCCGTGTCATACCAGCTGGTCATACGCGCTTTGG
CGCTTCATCTGGGATGATGGTGTGGGCATGACTTGTAGGGTTAAGAGGGAGAAGGCGAAGAAGGGGAGGTGGGCT
GAGTCTGAGATTCAGGCTTGA
Gene >Ophcf2|06871
ATGACCATCCCCCCCAAAGCAGCCCCCCGCCCAGACCACGACTTCATCTGGACCTACACCGAAGAACCCCACCGA
ACCCGCCGCCTCGCCATCATAAAAGCCCACCCGGAAGTAACGAAGCTATGCGGTCCGGAGCCCCTGACCAAGTAC
GTCGTCGCCCTGGTGGTGGCCCTACAAGTGACGACGGCGTGGGCCCTCTCCAGCGGCGACTTCTGGACCATGCGC
TTCTGGCTGGTTGCCTACGTCGTCGGCGCGACGGCCAACCAGAATCTCTTCCTGGCCATACATGAGATTTCGCAT
AATTTGGCCTTTCGTTCTCCGCTGGCGAATAGGGTCTTTGCCGTCTTTGCAAATTTACCCATCGGCGTACCCTAC
AGCGCTTCCTTTCGAGTTCGTTCACACCCACCCCTCTCCCCTTCTTTATATATTGGTTACGTCTCGTGCTGATGA
CGGGTAGCCATATCATCTCACCCATCACAAGTCCTTGGGCGTAGATGGCATCGACACCGATCTGCCCACCGCCCT
CGAAGCCGTCATCCTCGACTCCCTCCTGGGAAAAGCCTTCTTCTGCACCTTTCAGATCTTCTTCTACGCCATTCG
CCCCATGACAGTCTACCGCGTCCCCTTTACAAAACTACACGTCTTCAACGTCGTGATCCAAATCCTCTTCGACCT
CGCCATCATCCGATTCCTCTCCCCCACGGCACTAGCATATCTAATCCTCTCCTCCTTTCTGGCCGGAAGCCTCCA
CCCCCTCGCAGCGCATTTCATAGCAGAGCACTACGTCTACGACCTCCCCCAGCATCTAACCCGACAACCCTCCTC
CACCTCCACCTCCACCTCCACCTCCCCCGACACCCCCGTCCCAGAAACATTCTCCTACTACGGCCCCCTAAACTG
GCTAACCTACAACGTCGGCCTTCACAACGAACACCACGACTTCCCCGCCATCCCCTGGTCCCGCCTCCCGACGCT
GCGCAGAATCGCAGACGACTTCTACCGCGACCTCCCGTGTCATACCAGCTGGTCATACGCGCTTTGGCGCTTCAT
CTGGGATGATGGTGTGGGCATGACTTGTAGGGTTAAGAGGGAGAAGGCGAAGAAGGGGAGGTGGGCTGAGTCTGA
GATTCAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail