Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06870
Gene name
Locationscaffold_08:1275002..1276140
Strand+
Gene length (bp)1138
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00635 Motile_Sperm MSP (Major sperm protein) domain 1.1E-23 3 94

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 262 281 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 158.82 91.29 226.36
Alive In ants, during behavior modification 298.59 157.77 439.41
Dead In ants, recently dead 302.13 163.80 440.46

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.957989 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06870
MSVDIEPQDLNFRRPFTVEVSQILTIKNPTTTPLAFKVKTTAPKQYCVRPNAGRIEPGQRFDVTVLLQAMRTDPP
LDAKCRDKFLVQSAPITADKEFASIALVLESTEKGRIQERKIRVNWLPAAGSDHGASVPQTGTVTPNRQSMVNGR
NVSDTPTSRTYSSPRGTTDSNPPPSYSAESSFDNVDAKSERPKSAVSQAATTVSESAQSTYEELKAKLAQAEAQI
VMLKDNTLRQRGSKAGVSESTTTSGPVAQAVKQADGVPVQVVAILCLLSFLLAYFFF*
Coding >Ophcf2|06870
ATGTCGGTTGACATCGAGCCTCAGGACTTGAACTTTCGCCGCCCCTTTACTGTCGAGGTGTCGCAGATCTTGACA
ATCAAGAACCCGACCACGACGCCTCTCGCCTTCAAGGTCAAGACGACTGCTCCGAAACAATACTGCGTTCGACCG
AATGCGGGCCGCATCGAGCCGGGCCAGAGGTTCGATGTCACGGTTCTTCTCCAGGCCATGAGGACGGATCCTCCG
CTCGACGCAAAATGTCGCGACAAGTTTCTCGTTCAGTCGGCGCCGATTACGGCCGACAAAGAGTTTGCGAGCATT
GCTCTGGTGCTCGAGTCGACGGAAAAGGGGCGGATCCAAGAGCGCAAAATCCGTGTCAACTGGCTGCCTGCCGCC
GGCTCCGATCACGGCGCTTCCGTCCCTCAGACCGGGACCGTGACTCCAAACAGGCAGTCGATGGTGAATGGGCGA
AACGTCAGCGATACGCCCACGTCGCGCACCTACTCGTCCCCTCGAGGCACGACGGACTCGAATCCTCCTCCTTCC
TACTCGGCCGAGTCTTCCTTCGATAACGTAGACGCAAAGTCGGAGCGTCCCAAGTCGGCCGTTTCGCAAGCGGCT
ACGACGGTGTCCGAATCGGCTCAGTCGACGTACGAGGAGCTCAAGGCCAAGCTGGCCCAGGCCGAGGCCCAGATC
GTGATGCTCAAGGACAACACTCTCCGTCAGCGCGGTTCCAAGGCCGGCGTGAGCGAGAGCACCACGACGAGCGGC
CCCGTGGCGCAGGCCGTCAAGCAGGCGGACGGTGTGCCGGTGCAGGTGGTGGCCATCCTCTGTCTACTGAGCTTC
CTACTCGCCTACTTCTTCTTCTAG
Transcript >Ophcf2|06870
ATGTCGGTTGACATCGAGCCTCAGGACTTGAACTTTCGCCGCCCCTTTACTGTCGAGGTGTCGCAGATCTTGACA
ATCAAGAACCCGACCACGACGCCTCTCGCCTTCAAGGTCAAGACGACTGCTCCGAAACAATACTGCGTTCGACCG
AATGCGGGCCGCATCGAGCCGGGCCAGAGGTTCGATGTCACGGTTCTTCTCCAGGCCATGAGGACGGATCCTCCG
CTCGACGCAAAATGTCGCGACAAGTTTCTCGTTCAGTCGGCGCCGATTACGGCCGACAAAGAGTTTGCGAGCATT
GCTCTGGTGCTCGAGTCGACGGAAAAGGGGCGGATCCAAGAGCGCAAAATCCGTGTCAACTGGCTGCCTGCCGCC
GGCTCCGATCACGGCGCTTCCGTCCCTCAGACCGGGACCGTGACTCCAAACAGGCAGTCGATGGTGAATGGGCGA
AACGTCAGCGATACGCCCACGTCGCGCACCTACTCGTCCCCTCGAGGCACGACGGACTCGAATCCTCCTCCTTCC
TACTCGGCCGAGTCTTCCTTCGATAACGTAGACGCAAAGTCGGAGCGTCCCAAGTCGGCCGTTTCGCAAGCGGCT
ACGACGGTGTCCGAATCGGCTCAGTCGACGTACGAGGAGCTCAAGGCCAAGCTGGCCCAGGCCGAGGCCCAGATC
GTGATGCTCAAGGACAACACTCTCCGTCAGCGCGGTTCCAAGGCCGGCGTGAGCGAGAGCACCACGACGAGCGGC
CCCGTGGCGCAGGCCGTCAAGCAGGCGGACGGTGTGCCGGTGCAGGTGGTGGCCATCCTCTGTCTACTGAGCTTC
CTACTCGCCTACTTCTTCTTCTAG
Gene >Ophcf2|06870
ATGTCGGTTGACATCGAGCCTCAGGACTTGAACTTTCGCCGTGAGTCTCATCGCTTGGGGCAGCCCATTGGCGCG
TTCTGATCAACTATTAGGCCCCTTTACTGTCGAGGTGTCGCAGATCTTGACAATCAAGAACCCGACCACGACGCC
TCTCGCCTTCAAGGTATGCCTCTTCTGGTCCCGTTAATGTTGTGACTCGCTAACTCATCTCAGGTCAAGACGACT
GCTCCGAAACAGTTGGTCCATCTCTTCTCCTTCCTCGATTGCCTTCTGACGTCTCAAGATACTGCGTTCGACCGA
ATGCGGGCCGCATCGAGCCGGGCCAGAGGTTCGATGTCACGGGTACGCCATTCGCCTTTCGTTGACGTTCCGAGC
TGATGTGGCAGTAGTTCTTCTCCAGGCCATGAGGACGGATCCTCCGCTCGACGCAAAATGTCGCGACAAGTTTCT
CGTTCAGTCGGCGCCGATTACGGCCGACAAAGAGTTTGCGAGCATTGCTCTGGTGGTAAGTTGAAGAGTTTGGGT
GAGAGAACCAACTGACAATCCGGTAGCTCGAGTCGACGGAAAAGGGGCGGATCCAAGAGCGCAAAATCCGTGTCA
ACTGGCTGCCTGCCGCCGGCTCCGATCACGGCGCTTCCGTCCCTCAGACCGGGACCGTGACTCCAAACAGGCAGT
CGATGGTGAATGGGGTGGGTTACTCTGTAGCCGCTAAAAAGCCTACTCTAACAGTTCTCAGCGAAACGTCAGCGA
TACGCCCACGTCGCGCACCTACTCGTCCCCTCGAGGCACGACGGACTCGAATCCTCCTCCTTCCTACTCGGCCGA
GTCTTCCTTCGATAACGTAGACGCAAAGTCGGAGCGTCCCAAGTCGGCCGTTTCGCAAGCGGCTACGACGGTGTC
CGAATCGGCTCAGTCGACGTACGAGGAGCTCAAGGCCAAGCTGGCCCAGGCCGAGGCCCAGATCGTGATGCTCAA
GGACAACACTCTCCGTCAGCGCGGTTCCAAGGCCGGCGTGAGCGAGAGCACCACGACGAGCGGCCCCGTGGCGCA
GGCCGTCAAGCAGGCGGACGGTGTGCCGGTGCAGGTGGTGGCCATCCTCTGTCTACTGAGCTTCCTACTCGCCTA
CTTCTTCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail