Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06869
Gene name
Locationscaffold_08:1272937..1274023
Strand-
Gene length (bp)1086
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00789 UBX UBX domain 7.4E-07 238 315

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5562 0.4142 0.0338 0.0288 0.1809 0.0015 0.1026 0.0573 0.1599 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3965
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5742
Ophiocordyceps australis map64 (Brazil) OphauB2|4859
Ophiocordyceps camponoti-floridani Ophcf2|06869 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4743
Ophiocordyceps kimflemingae Ophio5|921
Ophiocordyceps subramaniannii Hirsu2|7905

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06869
MPSDLDQLLDMGFEKVRAEMAVKKSGGLQGALQWLEDNQEKSLEEIQDASNDANEDEDEAETRAKIAELETGKAR
SLVCNECGKRFRNQDLASYHATKTEHTDFSESTEELAPLTEDEKKAKLEELRERLKAKKAVQSVQDKEDQKRNEK
IRQKATKETQDAKEELQRKEQMKEVARKRQEKAEDMEAKKRIKAKIEADKAERRRKADEAKATRDGKLPESQPSA
VQTPAAPAAQPRSDRNEARLRLQLPSGNITKTLPAGTTLFELAQMVQTETGNAVTSFSTTLPRKTFEGDLDMSKT
LKEAGLVPSSVLIVK*
Coding >Ophcf2|06869
ATGCCTTCCGATCTGGACCAGCTGCTCGACATGGGCTTCGAAAAAGTCCGCGCCGAGATGGCCGTGAAAAAATCC
GGTGGCCTCCAAGGCGCTCTGCAGTGGCTGGAGGACAACCAGGAAAAGTCTCTGGAAGAGATCCAGGACGCTTCC
AACGATGCAAACGAAGATGAAGACGAAGCCGAGACGAGGGCCAAGATTGCAGAGCTGGAGACTGGCAAGGCCCGA
TCGCTGGTTTGCAACGAGTGTGGCAAGCGTTTCCGCAATCAAGATCTGGCAAGCTACCATGCCACCAAGACAGAG
CACACTGATTTCTCCGAATCGACCGAAGAATTAGCCCCCCTGACCGAAGACGAGAAAAAGGCCAAGCTGGAGGAA
CTCCGCGAGCGACTCAAGGCCAAAAAGGCCGTACAGTCCGTTCAGGACAAGGAAGATCAGAAGCGAAACGAGAAA
ATCCGCCAAAAGGCCACAAAAGAGACGCAAGACGCAAAGGAAGAGCTCCAGCGCAAAGAGCAGATGAAGGAAGTC
GCCCGCAAGCGCCAAGAAAAAGCCGAAGACATGGAAGCCAAAAAGCGCATCAAGGCCAAGATCGAAGCCGACAAG
GCCGAGCGACGCCGCAAGGCTGACGAGGCCAAGGCAACGCGCGACGGCAAGCTTCCCGAATCACAGCCGTCTGCC
GTACAAACTCCGGCCGCGCCCGCCGCACAGCCCAGATCGGACCGCAACGAGGCCAGGCTCAGGCTTCAGCTGCCA
TCGGGAAACATTACCAAGACGCTGCCGGCGGGAACGACGCTGTTTGAGCTGGCGCAAATGGTTCAGACCGAGACG
GGAAATGCCGTCACCAGTTTCTCTACGACGCTGCCGCGCAAAACCTTTGAAGGGGACCTCGACATGTCCAAGACG
CTCAAAGAGGCCGGGCTTGTGCCGTCGTCAGTACTCATCGTCAAGTAG
Transcript >Ophcf2|06869
ATGCCTTCCGATCTGGACCAGCTGCTCGACATGGGCTTCGAAAAAGTCCGCGCCGAGATGGCCGTGAAAAAATCC
GGTGGCCTCCAAGGCGCTCTGCAGTGGCTGGAGGACAACCAGGAAAAGTCTCTGGAAGAGATCCAGGACGCTTCC
AACGATGCAAACGAAGATGAAGACGAAGCCGAGACGAGGGCCAAGATTGCAGAGCTGGAGACTGGCAAGGCCCGA
TCGCTGGTTTGCAACGAGTGTGGCAAGCGTTTCCGCAATCAAGATCTGGCAAGCTACCATGCCACCAAGACAGAG
CACACTGATTTCTCCGAATCGACCGAAGAATTAGCCCCCCTGACCGAAGACGAGAAAAAGGCCAAGCTGGAGGAA
CTCCGCGAGCGACTCAAGGCCAAAAAGGCCGTACAGTCCGTTCAGGACAAGGAAGATCAGAAGCGAAACGAGAAA
ATCCGCCAAAAGGCCACAAAAGAGACGCAAGACGCAAAGGAAGAGCTCCAGCGCAAAGAGCAGATGAAGGAAGTC
GCCCGCAAGCGCCAAGAAAAAGCCGAAGACATGGAAGCCAAAAAGCGCATCAAGGCCAAGATCGAAGCCGACAAG
GCCGAGCGACGCCGCAAGGCTGACGAGGCCAAGGCAACGCGCGACGGCAAGCTTCCCGAATCACAGCCGTCTGCC
GTACAAACTCCGGCCGCGCCCGCCGCACAGCCCAGATCGGACCGCAACGAGGCCAGGCTCAGGCTTCAGCTGCCA
TCGGGAAACATTACCAAGACGCTGCCGGCGGGAACGACGCTGTTTGAGCTGGCGCAAATGGTTCAGACCGAGACG
GGAAATGCCGTCACCAGTTTCTCTACGACGCTGCCGCGCAAAACCTTTGAAGGGGACCTCGACATGTCCAAGACG
CTCAAAGAGGCCGGGCTTGTGCCGTCGTCAGTACTCATCGTCAAGTAG
Gene >Ophcf2|06869
ATGCCTTCCGATCTGGACCAGCTGCTCGACATGGGCTTCGAAAAAGTCCGCGCCGAGATGGCCGTGAAAAAATCC
GGTGGCCGTGCGTATCCCCTCGAGCTACGTCACCCCGCTAACGGCAGCTCAGTCCAAGGCGCTCTGCAGTGGCTG
GAGGACAACCAGGAAAAGTCTCTGGAAGAGATCCAGGACGCTTCCAACGATGCAAACGAAGATGAAGACGAAGCC
GAGACGAGGGCCAAGATTGCAGAGCTGGAGACTGGCAAGGCCCGATCGCTGGTTTGCAACGAGTGTGGCAAGCGT
TTCCGCAATCAAGATCTGGCAAGCTACCATGCCACCAAGACGTCGGTCACTCCTTTGAAATTGTGATGAGTTGCT
GATCCTTGCAGAGAGCACACTGATTTCTCCGAATCGACCGAAGAATTAGCCCCCCTGACCGAAGACGAGAAAAAG
GCCAAGCTGGAGGAACTCCGCGAGCGACTCAAGGCCAAAAAGGCCGTACAGTCCGTTCAGGACAAGGAAGATCAG
AAGCGAAACGAGGTAGACTATATACCGTCGTCTCACCGATATACGCTGACGATGACGCAGAAAATCCGCCAAAAG
GCCACAAAAGAGACGCAAGACGCAAAGGAAGAGCTCCAGCGCAAAGAGCAGATGAAGGAAGTCGCCCGCAAGCGC
CAAGAAAAAGCCGAAGACATGGAAGCCAAAAAGCGCATCAAGGCCAAGATCGAAGCCGACAAGGCCGAGCGACGC
CGCAAGGCTGACGAGGCCAAGGCAACGCGCGACGGCAAGCTTCCCGAATCACAGCCGTCTGCCGTACAAACTCCG
GCCGCGCCCGCCGCACAGCCCAGATCGGACCGCAACGAGGCCAGGCTCAGGCTTCAGCTGCCATCGGGAAACATT
ACCAAGACGCTGCCGGCGGGAACGACGCTGTTTGAGCTGGCGCAAATGGTTCAGACCGAGACGGGAAATGCCGTC
ACCAGTTTCTCTACGACGCTGCCGCGCAAAACCTTTGAAGGGGACCTCGACATGTCCAAGACGCTCAAAGAGGCC
GGGCTTGTGCCGTCGTCAGTACTCATCGTCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail