Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06868
Gene name
Locationscaffold_08:1271976..1272491
Strand+
Gene length (bp)515
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00428 Ribosomal_60s 60s Acidic ribosomal protein 1.2E-25 22 109

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6074 0.3473 0.0413 0.1275 0.0643 0.003 0.1 0.3228 0.3182 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3833
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5741
Ophiocordyceps australis map64 (Brazil) OphauB2|4858
Ophiocordyceps camponoti-floridani Ophcf2|06868 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4742
Ophiocordyceps kimflemingae Ophio5|922
Ophiocordyceps subramaniannii Hirsu2|7540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06868
MSSHAEKASSYAALILADDGAEITADKLQALIKAAKVEEVEPIWTNIFAKALSGKDVKDLLVNVGSGGGAALAAG
GAAPAGGDAAAPAAEEKKEEEKDESDEDMGFGLFD*
Coding >Ophcf2|06868
ATGTCTTCCCACGCTGAGAAAGCCTCGTCCTACGCGGCGCTGATTCTCGCCGATGATGGCGCCGAGATCACCGCC
GACAAGCTCCAGGCCCTGATCAAGGCTGCCAAAGTCGAGGAAGTCGAACCCATCTGGACCAACATCTTCGCCAAG
GCGCTGTCCGGCAAGGACGTCAAGGACCTGCTCGTCAACGTCGGCTCTGGAGGCGGTGCTGCCCTGGCTGCCGGA
GGTGCTGCCCCTGCAGGCGGTGACGCTGCCGCTCCCGCCGCGGAGGAGAAGAAGGAAGAGGAGAAAGACGAGTCG
GACGAGGATATGGGCTTCGGTCTCTTCGACTAA
Transcript >Ophcf2|06868
ATGTCTTCCCACGCTGAGAAAGCCTCGTCCTACGCGGCGCTGATTCTCGCCGATGATGGCGCCGAGATCACCGCC
GACAAGCTCCAGGCCCTGATCAAGGCTGCCAAAGTCGAGGAAGTCGAACCCATCTGGACCAACATCTTCGCCAAG
GCGCTGTCCGGCAAGGACGTCAAGGACCTGCTCGTCAACGTCGGCTCTGGAGGCGGTGCTGCCCTGGCTGCCGGA
GGTGCTGCCCCTGCAGGCGGTGACGCTGCCGCTCCCGCCGCGGAGGAGAAGAAGGAAGAGGAGAAAGACGAGTCG
GACGAGGATATGGGCTTCGGTCTCTTCGACTAA
Gene >Ophcf2|06868
ATGTCTTCCCACGCTGAGAAAGCCTCGTCCTACGCGGCGCTGATTCTCGCCGATGATGGCGCCGAGATCACCGTT
TGTCACTCCCCGCCGCGCCCAGACGCATCGCCCGCTAAATCCTGTGCAGGCCGACAAGCTCCAGGCCCTGATCAA
GGCTGCCAAAGTCGAGGAAGTCGAACCCATCTGGACCAACATCTTCGCCAAGGTATGATTACCTCTGTTGCGAGC
AATCGGACGTGACGGCGACGAGACCTCGAGGCGGCTGGCTGACTCTGGCGTAGGCGCTGTCCGGCAAGGACGTCA
AGGACCTGCTCGTCAACGTCGGCTCTGGAGGCGGTGCTGCCCTGGCTGCCGGAGGTGCTGCCCCTGCAGGCGGTG
ACGCTGCCGCTCCCGCCGCGGAGGAGAAGAAGGAAGAGGGTGCGTTGCCGGAATCCCAGTGCCAGCTCTTTTAAC
CCGCTGACACTGCTGCAGAGAAAGACGAGTCGGACGAGGATATGGGCTTCGGTCTCTTCGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail