Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06867
Gene name
Locationscaffold_08:1269965..1271539
Strand-
Gene length (bp)1574
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10303 DUF2408 Protein of unknown function (DUF2408) 3.9E-23 177 297

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7631 0.453 0.3728 0.0956 0.1271 0.0325 0.1069 0.117 0.081 0.0484

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 47.30 26.28 68.31
Alive In ants, during behavior modification 15.92 7.08 24.76
Dead In ants, recently dead 19.21 8.96 29.47

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.400794 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup3832
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5740
Ophiocordyceps australis map64 (Brazil) OphauB2|4857
Ophiocordyceps camponoti-floridani Ophcf2|06867 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4741
Ophiocordyceps kimflemingae Ophio5|923
Ophiocordyceps subramaniannii Hirsu2|7539

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06867
MDTPSAPAPRDVREQAILKRLEEVRDLLLLLKQDRTKYIRSQDIIPLYDQTIDQVKELNAVRAETGNKEENRLDR
VLDSCFQLLSLFYLTIGRNNEAPATYALTSTIKRLLDHLDETNLYSAKDLESISATLKKLSDSISTAKDQGTEAR
HSPFLLTLLAKRIELCQATLGNLQKRLERIAEPLLATHERLICILRQISLANTKAKFSATDVQKLRKQLVEIGDR
RKDGKFTAEDGSEPRGSPEICQLYDKCILWSDMVLDRKGMVPDQWRPTYDVLVGIRNDLEKLSLTQAWSLRETDL
YDFQRQLDKIDESRKNGNFHDDKGKPADLWTQRTMLYLIRRSYAYIYSFMLASEPVSEALLPIYNQLQTLKRCLM
EVQHNGGVSSVRELYPYSMKLSSMDKMRVDGKFVINGDVPEGQSSVSDLMDECFHINNYLRVSAEATDGDQK*
Coding >Ophcf2|06867
ATGGACACGCCTTCGGCTCCGGCGCCACGGGATGTCCGGGAGCAGGCCATCCTCAAGCGACTCGAGGAGGTTCGC
GACCTGTTGCTGCTTCTCAAGCAGGATCGCACCAAGTATATCCGCAGTCAAGATATTATTCCGCTCTACGACCAG
ACTATCGATCAGGTCAAGGAGCTCAACGCCGTCCGTGCTGAGACGGGCAACAAGGAGGAAAACAGACTGGACAGG
GTCCTGGATAGCTGTTTTCAGCTGCTGTCGCTGTTCTACTTGACCATTGGTCGCAACAACGAGGCCCCCGCCACG
TATGCTCTGACGTCGACCATTAAGCGGCTACTCGACCACCTCGATGAGACGAATCTCTACTCGGCCAAGGATCTG
GAGAGCATCAGCGCGACGCTAAAGAAGCTGTCCGATAGCATCAGCACCGCCAAAGACCAGGGAACCGAGGCTCGA
CATTCTCCCTTTCTCCTCACCCTCCTGGCCAAGAGAATCGAGCTGTGCCAGGCGACGCTGGGAAATCTTCAGAAA
CGGCTGGAGAGGATCGCGGAGCCGCTGCTGGCAACGCACGAGCGATTGATATGCATACTCCGCCAGATATCCCTA
GCAAATACAAAGGCCAAGTTCTCCGCGACAGACGTTCAGAAGCTGCGCAAGCAATTGGTCGAAATCGGCGACAGG
CGCAAGGACGGCAAGTTTACGGCCGAGGACGGCTCGGAGCCTCGTGGCAGCCCCGAGATATGCCAGTTGTACGAC
AAGTGCATCCTGTGGTCTGACATGGTGCTGGATCGCAAGGGCATGGTTCCCGATCAATGGCGGCCGACATACGAC
GTCCTCGTCGGGATTCGCAACGACCTAGAGAAGCTTTCCCTGACGCAGGCTTGGTCCCTGCGCGAGACGGATCTG
TACGACTTTCAACGCCAGCTGGACAAGATTGACGAGAGCCGGAAAAACGGCAACTTTCACGATGACAAGGGCAAG
CCGGCGGATCTCTGGACGCAGCGGACGATGCTGTACCTGATCCGACGGAGTTATGCCTACATCTACTCGTTCATG
CTTGCGTCGGAGCCGGTCTCGGAAGCGCTGCTGCCTATTTACAACCAACTGCAGACGCTGAAGCGGTGCCTCATG
GAGGTTCAGCACAATGGTGGCGTCTCGTCGGTGCGGGAATTGTATCCGTACAGCATGAAGTTGAGCTCGATGGAC
AAGATGAGAGTCGACGGAAAGTTTGTCATCAACGGCGACGTACCGGAAGGGCAATCGAGCGTCAGCGATCTGATG
GACGAGTGCTTTCATATCAACAACTATTTGCGAGTGTCGGCAGAAGCCACCGACGGGGATCAAAAGTAA
Transcript >Ophcf2|06867
ATGGACACGCCTTCGGCTCCGGCGCCACGGGATGTCCGGGAGCAGGCCATCCTCAAGCGACTCGAGGAGGTTCGC
GACCTGTTGCTGCTTCTCAAGCAGGATCGCACCAAGTATATCCGCAGTCAAGATATTATTCCGCTCTACGACCAG
ACTATCGATCAGGTCAAGGAGCTCAACGCCGTCCGTGCTGAGACGGGCAACAAGGAGGAAAACAGACTGGACAGG
GTCCTGGATAGCTGTTTTCAGCTGCTGTCGCTGTTCTACTTGACCATTGGTCGCAACAACGAGGCCCCCGCCACG
TATGCTCTGACGTCGACCATTAAGCGGCTACTCGACCACCTCGATGAGACGAATCTCTACTCGGCCAAGGATCTG
GAGAGCATCAGCGCGACGCTAAAGAAGCTGTCCGATAGCATCAGCACCGCCAAAGACCAGGGAACCGAGGCTCGA
CATTCTCCCTTTCTCCTCACCCTCCTGGCCAAGAGAATCGAGCTGTGCCAGGCGACGCTGGGAAATCTTCAGAAA
CGGCTGGAGAGGATCGCGGAGCCGCTGCTGGCAACGCACGAGCGATTGATATGCATACTCCGCCAGATATCCCTA
GCAAATACAAAGGCCAAGTTCTCCGCGACAGACGTTCAGAAGCTGCGCAAGCAATTGGTCGAAATCGGCGACAGG
CGCAAGGACGGCAAGTTTACGGCCGAGGACGGCTCGGAGCCTCGTGGCAGCCCCGAGATATGCCAGTTGTACGAC
AAGTGCATCCTGTGGTCTGACATGGTGCTGGATCGCAAGGGCATGGTTCCCGATCAATGGCGGCCGACATACGAC
GTCCTCGTCGGGATTCGCAACGACCTAGAGAAGCTTTCCCTGACGCAGGCTTGGTCCCTGCGCGAGACGGATCTG
TACGACTTTCAACGCCAGCTGGACAAGATTGACGAGAGCCGGAAAAACGGCAACTTTCACGATGACAAGGGCAAG
CCGGCGGATCTCTGGACGCAGCGGACGATGCTGTACCTGATCCGACGGAGTTATGCCTACATCTACTCGTTCATG
CTTGCGTCGGAGCCGGTCTCGGAAGCGCTGCTGCCTATTTACAACCAACTGCAGACGCTGAAGCGGTGCCTCATG
GAGGTTCAGCACAATGGTGGCGTCTCGTCGGTGCGGGAATTGTATCCGTACAGCATGAAGTTGAGCTCGATGGAC
AAGATGAGAGTCGACGGAAAGTTTGTCATCAACGGCGACGTACCGGAAGGGCAATCGAGCGTCAGCGATCTGATG
GACGAGTGCTTTCATATCAACAACTATTTGCGAGTGTCGGCAGAAGCCACCGACGGGGATCAAAAGTAA
Gene >Ophcf2|06867
ATGGACACGCCTTCGGCTCCGGCGCCACGGGATGTCCGGGAGCAGGCCATCCTCAAGCGACTCGAGGAGGTTCGC
GACCTGTTGCTGCTTCTCAAGCAGGATCGCACCAAGTATATCCGCAGTCAAGATATTATTCCGCTCTACGACCAG
ACTATCGATCAGGTCAAGGAGCTCAACGCCGTCCGTGCTGAGACGGGCAACAAGGAGGAAAACAGACGTACGCGT
TGCCTCGATAGTCTTTTCGCTTTCATAAAACATCGTCTCTCCTCTTGTCTTCTAACTCCCGATAGTGGACAGGGT
CCTGGATAGCTGTTTTCAGCTGCTGTCGCTGTTCTACTTGACCATTGGTCGCAACAACGAGGCCCCCGCCACGTA
TGCTCTGACGTCGACCATTAAGCGGCTACTCGACCACCTCGATGAGACGAATCTCTACTCGGCCAAGGATCTGGA
GAGCATCAGCGCGACGCTAAAGAAGCTGTCCGATAGCATCAGCACCGCCAAAGACCAGGGAACCGAGGCTCGACA
TTCTCCCTTTCTCCTCACCCTCCTGGCCAAGAGAATCGAGCTGTGCCAGGCGACGCTGGGAAATCTTCAGAAACG
GCTGGAGAGGATCGCGGAGCCGCTGCTGGCAACGCACGAGCGATTGATATGCATACTCCGCCAGATATCCCTAGC
AAATACAAAGGCCAAGGTAATTGTCGCAACACAATCCTAGACTGTCTTTTTTTGTCTGACGGTCGATGCACTCAG
TTCTCCGCGACAGACGTTCAGAAGCTGCGCAAGCAATTGGTCGAAATCGGCGACAGGCGCAAGGACGGCAAGTTT
ACGGCCGAGGACGGCTCGGAGCCTCGTGGCAGCCCCGAGATATGCCAGTTGTACGACAAGTGCATCCTGTGGTCT
GACATGGTGCTGGATCGGTACGACTCTCTGATTCCGCGTTCGTACTCTTCCTCTGACGATGACCAGCAAGGGCAT
GGTTCCCGATCAATGGCGGCCGACATACGACGTCCTCGTCGGGATTCGCAACGACCTAGAGAAGCTTTCCCTGAC
GCAGGCTTGGTCCCTGCGCGAGACGGATCTGTACGACTTTCAACGCCAGCTGGACAAGATTGACGAGAGCCGGAA
AAACGGCAACTTTCACGATGACAAGGGCAAGCCGGCGGATCTCTGGACGCAGCGGACGATGCTGTACCTGATCCG
ACGGAGTTATGCCTACATCTACTCGTTCATGCTTGCGTCGGAGCCGGTCTCGGAAGCGCTGCTGCCTATTTACAA
CCAACTGCAGACGCTGAAGCGGTGCCTCATGGAGGTTCAGCACAATGGTGGCGTCTCGTCGGTGCGGGAATTGTA
TCCGTACAGCATGAAGGTGCGCAGATTCGTTTGGACGTCTTACGAGCCGTACTGACTGCCGACAGTTGAGCTCGA
TGGACAAGATGAGAGTCGACGGAAAGTTTGTCATCAACGGCGACGTACCGGAAGGGCAATCGAGCGTCAGCGATC
TGATGGACGAGTGCTTTCATATCAACAACTATTTGCGAGTGTCGGCAGAAGCCACCGACGGGGATCAAAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail