Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06865
Gene name
Locationscaffold_08:1265659..1268131
Strand-
Gene length (bp)2472
Transcript length (bp)2316
Coding sequence length (bp)2316
Protein length (aa) 772

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 1.2E-18 17 106
PF14604 SH3_9 Variant SH3 domain 5.7E-11 720 768
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 3.6E-15 407 457

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6843 0.2089 0.0708 0.2673 0.1699 0.0053 0.2208 0.4389 0.2682 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3830
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4205
Ophiocordyceps australis map64 (Brazil) OphauB2|5239
Ophiocordyceps camponoti-floridani Ophcf2|06865 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4739
Ophiocordyceps kimflemingae Ophio5|925
Ophiocordyceps subramaniannii Hirsu2|7536

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06865
MAEVESSLSFGSRLKDGFRPASVWLGYNIAWLDEVQQFYRDRAVIEKEYSSKLTALARKYYEKKNKRSPLLSVGE
SPAMTPGSVENASLNAWSTQLNTLESRAAENDRFANNLVSQVAEPLKMMSARFDDLRKRHAEHADKLVAERDASA
AELRKVKAKYDAACLEVEAKRKKSESQSDKAKAQSAYQQQILEMNDAKNTYLIAINVANRQKHSYYNDYMPDLMD
SLQDLSQFRVQKLNEVWTVAVHLEDEALVQARVLMDSLALEIPRNEPQLDAVMYMRHNVGSSTEMADREFEPNPV
WHDDDAMVVNDTAKIYLRNVLTKSKAQLSDLRREVDKKRREVDAAKVLKRRVREGTEKNKDEADVVRSLFALQEE
LHALDRRRLTAEVEVSTITGAVGDVTLGAKNHNFKGQTFKMPTNCDLCGERIWGLSAKGFDCRDCGYTCHSKCEM
KVPADCPGEQTKEERKKLKAERQEAANRLLAPDPRPAHVAEPPPSSSALVRSDTMNSLSSASARRPGGPRTPTTD
DGQDGSTRTAGSTTATTPTTANTLSSDVRSPTLGARKRFMAPPPAAYIGEGGVANGVVKEEEMKKGRMMYAFEGS
GEGELSVPEGREVTQLEADDGSGWVKVRAGYKEGIVPLSYVDFSPTTTSTTGQLTTTTTTTPATTTTPATTTTTT
TPPPPARPSSTYSTSTTSSTTSAAKKRGPAVAPKRGAKKLRYVEALYGYAAQSPAEHSMREGERFVLVREDPGDG
WVEVEKAGVTATVPASYVRVV*
Coding >Ophcf2|06865
ATGGCCGAGGTCGAGTCCTCGCTCTCCTTCGGCTCCAGGCTCAAGGATGGCTTCAGGCCCGCCAGCGTATGGCTC
GGCTACAACATCGCCTGGCTCGACGAAGTTCAACAGTTTTATCGCGATCGCGCCGTCATCGAAAAGGAGTATAGC
TCGAAATTGACGGCCCTCGCCCGGAAATACTATGAGAAGAAGAACAAGAGATCGCCGCTGCTGAGCGTCGGCGAG
TCGCCCGCCATGACGCCAGGCTCGGTGGAAAACGCCTCTCTCAACGCCTGGTCTACTCAGCTCAACACCCTCGAG
TCTAGGGCAGCGGAAAACGACCGGTTCGCCAATAATCTCGTCTCGCAAGTGGCCGAGCCCCTCAAGATGATGAGC
GCCCGCTTCGACGATCTCCGCAAACGACATGCCGAACACGCCGATAAGCTGGTGGCCGAACGCGACGCCTCAGCC
GCCGAGCTGCGCAAGGTAAAGGCCAAGTACGACGCCGCCTGTCTCGAGGTAGAGGCCAAGCGCAAGAAGTCGGAG
TCGCAGTCGGACAAGGCCAAGGCACAGAGCGCGTACCAGCAGCAGATTCTCGAGATGAACGACGCGAAGAACACG
TACCTCATAGCCATCAACGTCGCCAACCGGCAGAAGCACAGCTACTACAACGACTACATGCCCGACCTCATGGAC
AGCCTGCAGGATCTAAGCCAGTTTCGCGTTCAGAAGCTCAACGAGGTCTGGACCGTCGCCGTACATCTCGAGGAT
GAAGCCTTGGTGCAGGCGCGCGTCCTGATGGACAGCCTGGCACTCGAGATTCCGCGAAACGAGCCGCAGCTCGAC
GCCGTCATGTACATGCGCCACAACGTCGGCTCCTCGACCGAGATGGCCGATCGCGAGTTCGAGCCGAACCCGGTG
TGGCACGATGACGACGCCATGGTGGTCAACGACACGGCAAAGATATATCTGCGCAACGTCCTGACCAAGTCCAAG
GCTCAACTCAGCGACCTGCGACGTGAAGTGGACAAGAAGCGACGCGAAGTAGACGCGGCCAAGGTGCTCAAGAGG
CGCGTCCGCGAAGGCACCGAAAAGAACAAGGACGAGGCCGACGTGGTGCGCTCCTTATTCGCGCTGCAAGAGGAG
CTGCACGCGCTGGACCGCCGCCGACTGACGGCCGAGGTCGAGGTGTCTACGATAACGGGCGCCGTCGGTGACGTG
ACGCTGGGGGCCAAGAATCACAACTTCAAGGGCCAGACGTTCAAGATGCCCACCAACTGCGACCTCTGCGGCGAG
CGCATCTGGGGTCTCAGCGCAAAGGGCTTCGACTGTCGAGACTGCGGCTACACGTGCCACAGCAAGTGCGAGATG
AAGGTGCCGGCCGATTGTCCGGGGGAGCAGACGAAAGAGGAGCGCAAGAAGCTCAAGGCCGAGCGTCAGGAGGCG
GCCAACCGGTTACTGGCGCCGGATCCGCGACCAGCGCACGTAGCCGAGCCACCGCCATCGTCTTCGGCCCTGGTG
CGCTCCGACACGATGAACTCTCTCAGCTCGGCGTCGGCGCGAAGACCGGGAGGACCGCGGACGCCTACGACGGAT
GACGGACAGGACGGATCGACGAGGACGGCGGGCAGCACGACGGCAACGACGCCCACGACGGCCAACACGCTCTCC
TCTGACGTCCGGAGCCCGACGCTGGGAGCGCGCAAGAGATTCATGGCTCCTCCGCCGGCGGCGTATATCGGCGAG
GGGGGGGTGGCCAACGGCGTGGTGAAGGAGGAAGAGATGAAGAAGGGGAGGATGATGTACGCGTTCGAGGGGAGT
GGTGAGGGGGAGCTTTCCGTGCCCGAGGGGAGGGAGGTTACGCAGTTGGAGGCGGATGATGGATCTGGTTGGGTC
AAGGTGCGGGCTGGGTATAAGGAAGGCATCGTGCCCCTGAGCTACGTGGATTTTTCACCGACGACGACCTCGACG
ACGGGCCAGTTAACAACAACAACAACAACAACACCAGCAACAACAACAACACCAGCAACAACAACAACAACAACA
ACACCACCGCCACCAGCCCGCCCAAGCTCAACATACTCCACCTCGACAACCTCGTCCACCACCTCAGCCGCCAAG
AAGCGCGGCCCCGCGGTAGCCCCCAAGCGAGGCGCCAAGAAACTGCGCTACGTCGAGGCGCTGTACGGGTACGCG
GCGCAGTCTCCGGCCGAGCACTCGATGCGCGAGGGGGAGAGGTTCGTGCTGGTCAGGGAGGATCCGGGCGATGGG
TGGGTCGAGGTCGAGAAGGCGGGCGTCACCGCCACCGTGCCGGCTAGTTACGTGAGGGTTGTGTGA
Transcript >Ophcf2|06865
ATGGCCGAGGTCGAGTCCTCGCTCTCCTTCGGCTCCAGGCTCAAGGATGGCTTCAGGCCCGCCAGCGTATGGCTC
GGCTACAACATCGCCTGGCTCGACGAAGTTCAACAGTTTTATCGCGATCGCGCCGTCATCGAAAAGGAGTATAGC
TCGAAATTGACGGCCCTCGCCCGGAAATACTATGAGAAGAAGAACAAGAGATCGCCGCTGCTGAGCGTCGGCGAG
TCGCCCGCCATGACGCCAGGCTCGGTGGAAAACGCCTCTCTCAACGCCTGGTCTACTCAGCTCAACACCCTCGAG
TCTAGGGCAGCGGAAAACGACCGGTTCGCCAATAATCTCGTCTCGCAAGTGGCCGAGCCCCTCAAGATGATGAGC
GCCCGCTTCGACGATCTCCGCAAACGACATGCCGAACACGCCGATAAGCTGGTGGCCGAACGCGACGCCTCAGCC
GCCGAGCTGCGCAAGGTAAAGGCCAAGTACGACGCCGCCTGTCTCGAGGTAGAGGCCAAGCGCAAGAAGTCGGAG
TCGCAGTCGGACAAGGCCAAGGCACAGAGCGCGTACCAGCAGCAGATTCTCGAGATGAACGACGCGAAGAACACG
TACCTCATAGCCATCAACGTCGCCAACCGGCAGAAGCACAGCTACTACAACGACTACATGCCCGACCTCATGGAC
AGCCTGCAGGATCTAAGCCAGTTTCGCGTTCAGAAGCTCAACGAGGTCTGGACCGTCGCCGTACATCTCGAGGAT
GAAGCCTTGGTGCAGGCGCGCGTCCTGATGGACAGCCTGGCACTCGAGATTCCGCGAAACGAGCCGCAGCTCGAC
GCCGTCATGTACATGCGCCACAACGTCGGCTCCTCGACCGAGATGGCCGATCGCGAGTTCGAGCCGAACCCGGTG
TGGCACGATGACGACGCCATGGTGGTCAACGACACGGCAAAGATATATCTGCGCAACGTCCTGACCAAGTCCAAG
GCTCAACTCAGCGACCTGCGACGTGAAGTGGACAAGAAGCGACGCGAAGTAGACGCGGCCAAGGTGCTCAAGAGG
CGCGTCCGCGAAGGCACCGAAAAGAACAAGGACGAGGCCGACGTGGTGCGCTCCTTATTCGCGCTGCAAGAGGAG
CTGCACGCGCTGGACCGCCGCCGACTGACGGCCGAGGTCGAGGTGTCTACGATAACGGGCGCCGTCGGTGACGTG
ACGCTGGGGGCCAAGAATCACAACTTCAAGGGCCAGACGTTCAAGATGCCCACCAACTGCGACCTCTGCGGCGAG
CGCATCTGGGGTCTCAGCGCAAAGGGCTTCGACTGTCGAGACTGCGGCTACACGTGCCACAGCAAGTGCGAGATG
AAGGTGCCGGCCGATTGTCCGGGGGAGCAGACGAAAGAGGAGCGCAAGAAGCTCAAGGCCGAGCGTCAGGAGGCG
GCCAACCGGTTACTGGCGCCGGATCCGCGACCAGCGCACGTAGCCGAGCCACCGCCATCGTCTTCGGCCCTGGTG
CGCTCCGACACGATGAACTCTCTCAGCTCGGCGTCGGCGCGAAGACCGGGAGGACCGCGGACGCCTACGACGGAT
GACGGACAGGACGGATCGACGAGGACGGCGGGCAGCACGACGGCAACGACGCCCACGACGGCCAACACGCTCTCC
TCTGACGTCCGGAGCCCGACGCTGGGAGCGCGCAAGAGATTCATGGCTCCTCCGCCGGCGGCGTATATCGGCGAG
GGGGGGGTGGCCAACGGCGTGGTGAAGGAGGAAGAGATGAAGAAGGGGAGGATGATGTACGCGTTCGAGGGGAGT
GGTGAGGGGGAGCTTTCCGTGCCCGAGGGGAGGGAGGTTACGCAGTTGGAGGCGGATGATGGATCTGGTTGGGTC
AAGGTGCGGGCTGGGTATAAGGAAGGCATCGTGCCCCTGAGCTACGTGGATTTTTCACCGACGACGACCTCGACG
ACGGGCCAGTTAACAACAACAACAACAACAACACCAGCAACAACAACAACACCAGCAACAACAACAACAACAACA
ACACCACCGCCACCAGCCCGCCCAAGCTCAACATACTCCACCTCGACAACCTCGTCCACCACCTCAGCCGCCAAG
AAGCGCGGCCCCGCGGTAGCCCCCAAGCGAGGCGCCAAGAAACTGCGCTACGTCGAGGCGCTGTACGGGTACGCG
GCGCAGTCTCCGGCCGAGCACTCGATGCGCGAGGGGGAGAGGTTCGTGCTGGTCAGGGAGGATCCGGGCGATGGG
TGGGTCGAGGTCGAGAAGGCGGGCGTCACCGCCACCGTGCCGGCTAGTTACGTGAGGGTTGTGTGA
Gene >Ophcf2|06865
ATGGCCGAGGTCGAGTCCTCGCTCTCCTTCGGCTCCAGGCTCAAGGTGAGTCTCGGTCGGCGATTCTCAGCCCCG
GCTGACGCGTCGTCAGGATGGCTTCAGGCCCGCCAGCGTATGGCTCGGCTACAACATCGCCTGGCTCGACGAAGT
TCAACAGTTTTATCGCGATCGCGCCGTCATCGAAAAGGAGTATAGCTCGAAATTGACGGCCCTCGCCCGGAAATA
CTATGAGAAGAAGAACAAGAGATCGCCGCTGCTGAGCGTCGGCGAGTCGCCCGCCATGACGCCAGGCTCGGTGGA
AAAGTGCCCGCGCTCTTCATCGCTTGACGTTGCTCTGTTTTGGCTGACGATTGGCTCTTCAGCGCCTCTCTCAAC
GCCTGGTCTACTCAGCTCAACACCCTCGAGTCTAGGGCAGCGGAAAACGACCGGTTCGCCAATAATCTCGTCTCG
CAAGTGGCCGAGCCCCTCAAGATGATGAGCGCCCGCTTCGACGATCTCCGCAAACGACATGCCGAACACGCCGAT
AAGCTGGTGGCCGAACGCGACGCCTCAGCCGCCGAGCTGCGCAAGGTAAAGGCCAAGTACGACGCCGCCTGTCTC
GAGGTAGAGGCCAAGCGCAAGAAGTCGGAGTCGCAGTCGGACAAGGCCAAGGCACAGAGCGCGTACCAGCAGCAG
ATTCTCGAGATGAACGACGCGAAGAACACGTACCTCATAGCCATCAACGTCGCCAACCGGCAGAAGCACAGCTAC
TACAACGACTACATGCCCGACCTCATGGACAGCCTGCAGGATCTAAGCCAGTTTCGCGTTCAGAAGCTCAACGAG
GTCTGGACCGTCGCCGTACATCTCGAGGATGAAGCCTTGGTGCAGGCGCGCGTCCTGATGGACAGCCTGGCACTC
GAGATTCCGCGAAACGAGCCGCAGCTCGACGCCGTCATGTACATGCGCCACAACGTCGGCTCCTCGACCGAGATG
GCCGATCGCGAGTTCGAGCCGAACCCGGTGTGGCACGATGACGACGCCATGGTGGTCAACGACACGGCAAAGATA
TATCTGCGCAACGTCCTGACCAAGTCCAAGGCTCAACTCAGCGACCTGCGACGTGAAGTGGACAAGAAGCGACGC
GAAGTAGACGCGGCCAAGGTGCTCAAGAGGCGCGTCCGCGAAGGCACCGAAAAGAACAAGGACGAGGCCGACGTG
GTGCGCTCCTTATTCGCGCTGCAAGAGGAGCTGCACGCGCTGGACCGCCGCCGACTGACGGCCGAGGTCGAGGTG
TCTACGATAACGGGCGCCGTCGGTGACGTGACGCTGGGGGCCAAGAATCACAACTTCAAGGGCCAGACGTTCAAG
ATGCCCACCAACTGCGACCTCTGCGGCGAGCGCATCTGGGGTCTCAGCGCAAAGGGCTTCGACTGTCGAGACTGC
GGCTACACGTGCCACAGCAAGTGCGAGATGAAGGTGCCGGCCGATTGTCCGGGGGAGCAGACGAAAGAGGAGCGC
AAGAAGCTCAAGGCCGAGCGTCAGGAGGCGGCCAACCGGTTACTGGCGCCGGATCCGCGACCAGCGCACGTAGCC
GAGCCACCGCCATCGTCTTCGGCCCTGGTGCGCTCCGACACGATGAACTCTCTCAGCTCGGCGTCGGCGCGAAGA
CCGGGAGGACCGCGGACGCCTACGACGGATGACGGACAGGACGGATCGACGAGGACGGCGGGCAGCACGACGGCA
ACGACGCCCACGACGGCCAACACGCTCTCCTCTGACGTCCGGAGCCCGACGCTGGGAGCGCGCAAGAGATTCATG
GCTCCTCCGCCGGCGGCGTATATCGGCGAGGGGGGGGTGGCCAACGGCGTGGTGAAGGAGGAAGAGATGAAGAAG
GGGAGGATGATGTACGCGTTCGAGGGGAGTGGTGAGGGGGAGCTTTCCGTGCCCGAGGGGAGGGAGGTTACGCAG
TTGGAGGCGGATGGTGAGCTGTTTGTGATTGTGATTGACGGTGGGCTTTGCTGACTTTTGAAAGATGGATCTGGT
TGGGTCAAGGTGCGGGCTGGGTATAAGGAAGGCATCGTGCCCCTGAGCTACGTGGATTTTTCACCGACGACGACC
TCGACGACGGGCCAGTTAACAACAACAACAACAACAACACCAGCAACAACAACAACACCAGCAACAACAACAACA
ACAACAACACCACCGCCACCAGCCCGCCCAAGCTCAACATACTCCACCTCGACAACCTCGTCCACCACCTCAGCC
GCCAAGAAGCGCGGCCCCGCGGTAGCCCCCAAGCGAGGCGCCAAGAAACTGCGCTACGTCGAGGCGCTGTACGGG
TACGCGGCGCAGTCTCCGGCCGAGCACTCGATGCGCGAGGGGGAGAGGTTCGTGCTGGTCAGGGAGGATCCGGGC
GATGGGTGGGTCGAGGTCGAGAAGGCGGGCGTCACCGCCACCGTGCCGGCTAGTTACGTGAGGGTTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail