Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06857
Gene name
Locationscaffold_08:1240969..1242312
Strand+
Gene length (bp)1343
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 1.6E-65 7 384

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Peroxisome Peroxisomal targeting signal 0.5902 0.676 0.0508 0.0321 0.171 0.0203 0.0855 0.0838 0.0264 0.7878

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5093
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6159
Ophiocordyceps australis map64 (Brazil) OphauB2|4680
Ophiocordyceps camponoti-floridani Ophcf2|06857 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3371
Ophiocordyceps kimflemingae Ophio5|934
Ophiocordyceps subramaniannii Hirsu2|308

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06857
MSTKIKVRNPVVELDGDEMTRVIWKDIKQRFILPYLDIDLKYYDLGLEYRDETNDQVTLDAAEAIKKYSVGVKCA
TITPDEARVKEFKLKKSTVFREPIVIPRIPRLIPGWKNPIIIGRHAFGDQYRAKDMVVPGPGKLSMVYTPDGGSP
QEIQVFRFEGGGVGQTQYNTDESITGFAHASFKLAIDKCLPLYMSTKNTILKKYDGRFKDIFQHLYESQYKTHFE
AKGIWYEHRLIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRH
YREHQKGKETSTNPIASIFAWTRGLAQRGKLDGTPDLVAFAERLEKACVDTVDVDGIMTKDLALACGNKERSGYV
TTSEYMTAVERRLKREKGDVKL*
Coding >Ophcf2|06857
ATGTCCACCAAGATCAAGGTCCGGAATCCCGTCGTAGAGCTCGACGGTGATGAAATGACGCGCGTCATCTGGAAA
GACATCAAGCAGCGCTTCATACTCCCGTATCTCGACATTGACCTCAAATACTACGATCTCGGACTCGAGTATCGT
GATGAGACCAACGATCAAGTCACGCTCGACGCCGCAGAGGCCATCAAGAAATACTCCGTCGGCGTCAAGTGCGCC
ACCATAACGCCAGACGAGGCTCGCGTCAAGGAATTCAAGTTGAAGAAGAGCACCGTCTTCCGAGAACCCATCGTC
ATCCCTCGAATCCCCCGTCTGATTCCCGGCTGGAAAAACCCAATCATCATCGGCCGTCACGCCTTTGGCGATCAA
TACCGCGCCAAAGACATGGTCGTTCCTGGGCCGGGCAAGCTCTCCATGGTCTACACCCCGGACGGCGGCTCTCCC
CAAGAGATACAAGTCTTTCGCTTCGAGGGCGGGGGCGTTGGACAGACGCAGTACAATACGGACGAATCCATCACC
GGCTTTGCCCACGCTTCGTTCAAGCTCGCCATTGACAAGTGTCTCCCATTATACATGAGCACGAAAAATACCATT
CTCAAGAAATACGACGGCCGCTTCAAAGACATTTTTCAACATCTCTACGAGTCGCAGTACAAGACCCATTTCGAA
GCAAAAGGCATCTGGTACGAGCACCGCCTGATCGACGACATGGTGGCCCAGATGATCAAGAGCAGCGGAGGCTAC
ATTATGGCTTTGAAGAACTACGACGGAGACGTCCAGTCCGACATCGTCGCCCAAGGCTTCGGCTCCCTCGGCCTC
ATGACCTCCGTCCTCATCACCCCCGACGGTAAAACCTTTGAATCCGAAGCCGCACACGGCACCGTAACGCGCCAC
TACCGCGAGCACCAAAAAGGAAAGGAGACGTCTACGAACCCCATTGCCTCTATATTCGCCTGGACGCGCGGGCTG
GCTCAGCGTGGCAAGCTCGACGGCACGCCTGACCTGGTCGCCTTTGCGGAGAGGCTGGAAAAGGCGTGTGTCGAT
ACCGTCGACGTCGATGGCATCATGACAAAGGATCTTGCTCTGGCGTGTGGGAACAAGGAGCGTTCTGGCTATGTT
ACCACGTCGGAGTACATGACCGCCGTTGAGCGGAGGCTGAAGAGGGAAAAGGGGGACGTGAAGCTGTAA
Transcript >Ophcf2|06857
ATGTCCACCAAGATCAAGGTCCGGAATCCCGTCGTAGAGCTCGACGGTGATGAAATGACGCGCGTCATCTGGAAA
GACATCAAGCAGCGCTTCATACTCCCGTATCTCGACATTGACCTCAAATACTACGATCTCGGACTCGAGTATCGT
GATGAGACCAACGATCAAGTCACGCTCGACGCCGCAGAGGCCATCAAGAAATACTCCGTCGGCGTCAAGTGCGCC
ACCATAACGCCAGACGAGGCTCGCGTCAAGGAATTCAAGTTGAAGAAGAGCACCGTCTTCCGAGAACCCATCGTC
ATCCCTCGAATCCCCCGTCTGATTCCCGGCTGGAAAAACCCAATCATCATCGGCCGTCACGCCTTTGGCGATCAA
TACCGCGCCAAAGACATGGTCGTTCCTGGGCCGGGCAAGCTCTCCATGGTCTACACCCCGGACGGCGGCTCTCCC
CAAGAGATACAAGTCTTTCGCTTCGAGGGCGGGGGCGTTGGACAGACGCAGTACAATACGGACGAATCCATCACC
GGCTTTGCCCACGCTTCGTTCAAGCTCGCCATTGACAAGTGTCTCCCATTATACATGAGCACGAAAAATACCATT
CTCAAGAAATACGACGGCCGCTTCAAAGACATTTTTCAACATCTCTACGAGTCGCAGTACAAGACCCATTTCGAA
GCAAAAGGCATCTGGTACGAGCACCGCCTGATCGACGACATGGTGGCCCAGATGATCAAGAGCAGCGGAGGCTAC
ATTATGGCTTTGAAGAACTACGACGGAGACGTCCAGTCCGACATCGTCGCCCAAGGCTTCGGCTCCCTCGGCCTC
ATGACCTCCGTCCTCATCACCCCCGACGGTAAAACCTTTGAATCCGAAGCCGCACACGGCACCGTAACGCGCCAC
TACCGCGAGCACCAAAAAGGAAAGGAGACGTCTACGAACCCCATTGCCTCTATATTCGCCTGGACGCGCGGGCTG
GCTCAGCGTGGCAAGCTCGACGGCACGCCTGACCTGGTCGCCTTTGCGGAGAGGCTGGAAAAGGCGTGTGTCGAT
ACCGTCGACGTCGATGGCATCATGACAAAGGATCTTGCTCTGGCGTGTGGGAACAAGGAGCGTTCTGGCTATGTT
ACCACGTCGGAGTACATGACCGCCGTTGAGCGGAGGCTGAAGAGGGAAAAGGGGGACGTGAAGCTGTAA
Gene >Ophcf2|06857
ATGTCCACCAAGATCAAGGTCCGGAATCCCGTCGTAGAGCTCGACGGTGATGAAATGACGCGCGTCATCTGGAAA
GACATCAAGCAGCGCTTCATACTCCCGTATCTCGACATTGACCTCAAATACTACGATCTCGGACTCGAGTATCGT
GATGAGACCAACGATCAAGTCACGCTCGACGCCGCAGAGGCCATCAAGAAATACTCCGTCGGCGTCAAGTGCGCC
ACCATAACGCCAGACGAGGCTCGCGTCAAGGAATTCAAGTTGAAGAAGAGTAAGTCATCATCTCTGACGACGCCA
TGCATCCTAACCCCCCTATCGTGTGGCTCTCTCCCAACGGCACCATCCGCAACGCCCTCGGAGGCACCGTCTTCC
GAGAACCCATCGTCATCCCTCGAATCCCCCGTCTGATTCCCGGCTGGAAAAACCCAATCATCATCGGCCGTCACG
CCTTTGGCGATCAATACCGCGCCAAAGACATGGTCGTTCCTGGGCCGGGCAAGCTCTCCATGGTCTACACCCCGG
ACGGCGGCTCTCCCCAAGAGATACAAGTCTTTCGCTTCGAGGGCGGGGGCGTTGGACAGACGCAGTACAATACGG
ACGAATCCATCACCGGCTTTGCCCACGCTTCGTTCAAGCTCGCCATTGACAAGTGTCTCCCATTATACATGAGCA
CGAAAAATACCATTCTCAAGAAATACGACGGCCGCTTCAAAGACATTTTTCAACATCTCTACGAGTCGCAGTACA
AGACCCATTTCGAAGCAAAAGGCATCTGGTACGAGCACCGCCTGATCGACGACATGGTGGCCCAGATGATCAAGA
GCAGCGGAGGCTACATTATGGCTTTGAAGAGTGAGTCACCTTGCATTATCACTGTCTCTACCCTTACTTACCACC
CAACTCCCTACCTAGACTACGACGGAGACGTCCAGTCCGACATCGTCGCCCAAGGCTTCGGCTCCCTCGGCCTCA
TGACCTCCGTCCTCATCACCCCCGACGGTAAAACCTTTGAATCCGAAGCCGCACACGGCACCGTAACGCGCCACT
ACCGCGAGCACCAAAAAGGAAAGGAGACGTCTACGAACCCCATTGCCTCTATATTCGCCTGGACGCGCGGGCTGG
CTCAGCGTGGCAAGCTCGACGGCACGCCTGACCTGGTCGCCTTTGCGGAGAGGCTGGAAAAGGCGTGTGTCGATA
CCGTCGACGTCGATGGCATCATGACAAAGGATCTTGCTCTGGCGTGTGGGAACAAGGAGCGTTCTGGCTATGTTA
CCACGTCGGAGTACATGACCGCCGTTGAGCGGAGGCTGAAGAGGGAAAAGGGGGACGTGAAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail