Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06854
Gene name
Locationscaffold_08:1230173..1231059
Strand+
Gene length (bp)886
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0992 0.0374 0.9718 0.0385 0.0577 0.0052 0.0789 0.1085 0.0977 0.0022

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999769

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6738
Ophiocordyceps australis 1348a (Ghana) OphauG2|784
Ophiocordyceps australis map64 (Brazil) OphauB2|1368
Ophiocordyceps australis map64 (Brazil) OphauB2|4853
Ophiocordyceps camponoti-floridani Ophcf2|06380
Ophiocordyceps camponoti-floridani Ophcf2|06854 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3358
Ophiocordyceps camponoti-rufipedis Ophun1|7054
Ophiocordyceps kimflemingae Ophio5|3331
Ophiocordyceps kimflemingae Ophio5|6004
Ophiocordyceps subramaniannii Hirsu2|56
Ophiocordyceps subramaniannii Hirsu2|9193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06854
MVRLIIISALALVASVNALKPDPAGAKNKGNGQGGQFIGGECLSTADCASTCCCAVEGEDFMLCSGIGAQFQSGK
LGCASGSQKGANGNGNGGGNGVQGLGNGGNSSGQGSQVSAPQPGQQGAQSNDPSLARVGKGAGDQFITGPCASNA
DCSTGCCASNEKDPNKATCSAVLVSKDGGKLGCGTGPGDKGLNGGNDV*
Coding >Ophcf2|06854
ATGGTTCGCTTGATCATCATCTCTGCGCTTGCGCTGGTCGCGAGCGTCAACGCTTTGAAGCCCGACCCTGCCGGT
GCTAAAAACAAAGGAAACGGTCAAGGAGGACAATTTATCGGGGGCGAATGCCTCAGTACGGCTGATTGTGCTTCC
ACGTGCTGCTGCGCAGTAGAGGGCGAGGATTTCATGCTTTGTTCAGGCATTGGAGCTCAGTTTCAAAGCGGAAAG
TTGGGCTGCGCTTCGGGCTCCCAGAAGGGTGCCAATGGCAACGGTAATGGAGGAGGGAACGGCGTTCAGGGACTC
GGAAACGGAGGAAACTCAAGCGGTCAAGGTTCCCAAGTTTCAGCACCCCAACCTGGTCAACAGGGCGCGCAGAGC
AACGACCCGAGCCTGGCAAGAGTCGGAAAAGGGGCGGGCGACCAATTCATCACGGGCCCCTGTGCGTCCAACGCC
GACTGTTCTACCGGTTGCTGTGCTTCAAATGAAAAAGACCCGAACAAAGCGACGTGCAGTGCTGTCTTGGTCAGC
AAAGATGGAGGCAAGCTCGGTTGCGGAACGGGTCCCGGCGATAAGGGCTTGAACGGTGGCAATGACGTCTGA
Transcript >Ophcf2|06854
ATGGTTCGCTTGATCATCATCTCTGCGCTTGCGCTGGTCGCGAGCGTCAACGCTTTGAAGCCCGACCCTGCCGGT
GCTAAAAACAAAGGAAACGGTCAAGGAGGACAATTTATCGGGGGCGAATGCCTCAGTACGGCTGATTGTGCTTCC
ACGTGCTGCTGCGCAGTAGAGGGCGAGGATTTCATGCTTTGTTCAGGCATTGGAGCTCAGTTTCAAAGCGGAAAG
TTGGGCTGCGCTTCGGGCTCCCAGAAGGGTGCCAATGGCAACGGTAATGGAGGAGGGAACGGCGTTCAGGGACTC
GGAAACGGAGGAAACTCAAGCGGTCAAGGTTCCCAAGTTTCAGCACCCCAACCTGGTCAACAGGGCGCGCAGAGC
AACGACCCGAGCCTGGCAAGAGTCGGAAAAGGGGCGGGCGACCAATTCATCACGGGCCCCTGTGCGTCCAACGCC
GACTGTTCTACCGGTTGCTGTGCTTCAAATGAAAAAGACCCGAACAAAGCGACGTGCAGTGCTGTCTTGGTCAGC
AAAGATGGAGGCAAGCTCGGTTGCGGAACGGGTCCCGGCGATAAGGGCTTGAACGGTGGCAATGACGTCTGA
Gene >Ophcf2|06854
ATGGTTCGCTTGATCATCATCTCTGCGCTTGCGCGTAAGTCGTCAAGATCTCACTCAAAATCCCTTTCATCAACG
TCGGCCTCATGACTGACTCGAAATCTCTTTCAGTGGTCGCGAGCGTCAACGCTTTGAAGCCCGACCCTGCCGGTG
CTAAAAACAAAGGAAACGGTCAAGGAGTTTGTCTGCCCTTGATTTCTCTACTATTACCCATGTCTAATCCTCATC
AGGGACAATTTATCGGGGGCGAATGCCTCAGTACGGCTGATTGTGCTTCCACGTGCTGCTGCGCAGTAGAGGGCG
AGGATTTCATGCTTTGTTCAGGCATTGGAGCTCAGTTTCAAAGCGGAAAGTTGGGCTGCGCTTCGGGTAAGCACT
TGATCTTTTATCCATGTCGTTTTCTCGCTTTTGCTGACCGTATCTAGGCTCCCAGAAGGGTGCCAATGGCAACGG
TAATGGAGGAGGGAACGGCGTTCAGGGACTCGGAAACGGAGGAAACTCAAGCGGTCAAGGTTCCCAAGTTTCAGC
ACCCCAACCTGGTCAACAGGGCGCGCAGAGCAACGACCCGAGCCTGGCAAGAGTCGGAAAAGGGGCGGGCGACCA
ATTCATCACGGGCCCCTGTGCGTCCAACGCCGACTGTTCTACCGTGAGAAGGTCCAATTCTTTCTCGTTTGACGC
CAGTTGCTAACTTGGATTGCAAGGGTTGCTGTGCTTCAAATGAAAAAGACCCGAACAAAGCGACGTGCAGTGCTG
TCTTGGTCAGCAAAGATGGAGGCAAGCTCGGTTGCGGAACGGGTAAGGAAGACTCGAATACTCTGTCTTGATATC
TATCTAACCTGAGTATACAGGTCCCGGCGATAAGGGCTTGAACGGTGGCAATGACGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail