Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06853
Gene name
Locationscaffold_08:1224656..1227571
Strand+
Gene length (bp)2915
Transcript length (bp)2700
Coding sequence length (bp)2700
Protein length (aa) 900

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 4.2E-73 231 393
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.0E-27 159 230
PF03142 Chitin_synth_2 Chitin synthase 4.5E-17 371 545
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 3.2E-06 373 617

GO

GO Term Description Terminal node
GO:0006031 chitin biosynthetic process Yes
GO:0004100 chitin synthase activity Yes
GO:0016758 hexosyltransferase activity No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:0006022 aminoglycan metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006030 chitin metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0006040 amino sugar metabolic process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 576 595 19
2 616 638 22
3 653 675 22
4 694 716 22
5 726 745 19
6 825 847 22
7 871 893 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 80.16 43.88 116.43
Alive In ants, during behavior modification 168.26 72.21 264.31
Dead In ants, recently dead 137.22 68.41 206.03

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000851 yes
Alive Dead 0.323322 no
Dead Fungus 0.006475 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06853
MSYNRLDYHDPMDRRGRPYRTPSPGQPLQQGYQLDESPYGQQRLTPGPPSHQRLGTPSDQLNIHAASTVEHLPYS
GSRGYGDAVVNPQLLHDEYGGTHPNYPSQDGYFDPQTHGYEVDDRRPMLDYHSTPGYDDPYHDHPQQQQQQQQQQ
QLRRWKTVKQVLLYRGNLVLDCPVPPVLLQQNQHGERDEFTHMRYSAATCDPSEFYNENFTLRQQLFSKPRHTEL
FIVITMYNEDDILFARTLIGVFKNIEYMCNRPNSKTWGNEAWKKIVVCVVSDGRAKINPRTKAVLSGMGVYQEGI
AKQQVNNKDVTAHIYEYTTQTHLQLKNDTVVLVHRRRPVQMIFCLKEKNQKKINSHRWFFQAFGRVLDPNICVLL
DAGTRPGGNSIYHLWKAFDLEPMCGGACGEIKAMLGTGGKNLVNPLVATQNFEYKMSNILDKPLESAFGFISVLP
GAFSAYRYVALQNDKNGKGPLEKYFLGETLHGGSNAGLFESNMYLAEDRILCFELVTKRNCHWILQYVKSANGET
DVPDTVTELVLQRRRWLNGSFFAAVYAIAHFHEFFRSDHSIFRKLGFFFEFVFQTINMIFAWFAIGNFFLVFKIL
TTSLGSPELLGRVGEILSVVFTWLYGVILITCFVLSMGNRPAGSGRLYTAMVWFWAGIMIYLLFAAVFIAVKAII
ADLNNGRPFNIREIFTNQVFYTLIVSVMSTYGIWLLASLLMFDPWHMITSFVQYMLLSPTYTNVLNVYAFCNTHD
VSWGTKGDDTVEKLPSVNTKDGQGKTDLPDEGDLNAQYQREVAIFSAKYKAVKTKPTAAQLQEKQLDYYRGVRTG
VVLIWMITNFALAALVLSSAGLEKITPGRGSQADEETARANLYMAIVLWSVAALSSFKFLGALWFLIIRLFRGV*
Coding >Ophcf2|06853
ATGTCATACAATCGCCTCGACTATCACGATCCCATGGACCGTCGCGGCCGTCCTTATCGGACGCCTTCTCCTGGC
CAGCCGCTGCAGCAGGGATATCAACTCGACGAAAGCCCCTATGGCCAGCAGCGACTCACCCCCGGTCCACCGAGC
CATCAGCGTCTCGGCACCCCGAGCGACCAACTCAATATACATGCTGCGTCCACCGTCGAACACCTCCCTTACTCG
GGCTCAAGAGGCTATGGCGACGCCGTCGTCAACCCACAGCTCCTCCACGACGAATACGGCGGCACGCACCCCAAC
TATCCCTCGCAAGACGGCTACTTTGATCCTCAGACTCACGGATACGAGGTCGACGACCGCCGCCCGATGCTCGAC
TATCACAGCACGCCCGGCTACGACGACCCGTACCATGATCACCCGCAACAACAACAGCAGCAGCAGCAGCAGCAG
CAACTGAGGCGCTGGAAGACGGTCAAGCAGGTCCTGCTCTACCGCGGAAACCTCGTTCTCGACTGTCCCGTGCCG
CCCGTCCTCCTGCAACAGAATCAGCACGGCGAGCGCGACGAGTTTACACACATGCGCTACTCGGCCGCGACCTGC
GATCCTTCCGAGTTTTACAATGAAAATTTTACCCTCCGCCAGCAGTTGTTCAGCAAGCCGCGACACACTGAGCTT
TTCATCGTCATAACCATGTATAACGAAGACGATATTCTGTTTGCCCGCACCCTCATTGGCGTTTTCAAGAACATC
GAGTACATGTGCAACCGACCGAATAGCAAGACTTGGGGGAATGAGGCTTGGAAAAAGATTGTCGTCTGCGTCGTC
AGCGACGGTCGCGCAAAGATTAATCCTCGGACAAAGGCTGTCCTCTCCGGCATGGGCGTCTACCAAGAGGGTATT
GCCAAGCAGCAGGTCAACAACAAGGACGTGACGGCTCATATCTACGAGTACACGACGCAGACGCATCTACAGCTC
AAGAATGACACCGTCGTGCTCGTCCACCGTCGTCGGCCGGTACAGATGATTTTCTGCCTCAAGGAGAAGAATCAG
AAGAAAATAAATTCCCACCGCTGGTTCTTCCAGGCGTTTGGACGCGTCTTGGATCCCAACATTTGCGTCCTTCTC
GACGCCGGAACCCGACCTGGAGGCAACTCCATCTACCACCTCTGGAAAGCCTTTGATCTCGAACCAATGTGCGGC
GGCGCCTGCGGTGAAATCAAGGCCATGCTCGGAACCGGCGGCAAAAACCTCGTCAATCCCCTCGTGGCGACGCAG
AATTTCGAATACAAGATGAGCAACATCCTCGACAAGCCGTTGGAATCCGCCTTTGGCTTCATTTCTGTCCTTCCC
GGCGCCTTTTCCGCCTACCGCTACGTCGCCCTTCAAAACGACAAGAACGGCAAAGGACCGCTGGAAAAGTATTTC
CTCGGCGAGACGCTTCACGGCGGTAGCAACGCCGGTCTCTTCGAATCCAACATGTACCTCGCCGAAGACCGCATC
CTCTGTTTCGAGCTCGTCACCAAGCGCAACTGCCACTGGATCCTGCAGTACGTGAAGTCGGCCAACGGAGAGACG
GACGTCCCAGACACCGTCACCGAGCTGGTGCTGCAGCGACGACGATGGCTCAACGGATCCTTTTTCGCCGCCGTC
TACGCCATTGCTCACTTTCACGAATTCTTCCGCTCCGATCACTCTATCTTTCGCAAGCTCGGCTTCTTCTTCGAG
TTTGTCTTTCAGACCATCAACATGATTTTCGCCTGGTTTGCCATTGGCAACTTTTTCCTCGTCTTCAAAATCCTC
ACCACCAGCCTGGGGTCCCCGGAGCTGCTCGGTAGGGTCGGGGAGATTCTCAGCGTCGTCTTTACCTGGCTGTAC
GGTGTCATTCTGATCACCTGCTTTGTCCTGTCCATGGGCAATCGCCCGGCAGGTTCGGGGAGGCTATACACCGCC
ATGGTCTGGTTCTGGGCCGGCATCATGATCTACCTCCTCTTTGCCGCCGTCTTCATCGCCGTCAAGGCCATCATC
GCCGACCTCAACAACGGCCGACCCTTTAATATCCGGGAAATCTTTACCAACCAAGTCTTTTACACCCTCATCGTC
TCCGTCATGTCCACCTATGGCATCTGGCTCCTCGCCTCGCTGCTGATGTTCGACCCATGGCACATGATTACTTCT
TTCGTCCAATACATGCTGCTGTCGCCGACGTACACCAACGTGCTGAACGTCTACGCCTTTTGCAACACGCACGAC
GTCTCGTGGGGAACAAAAGGCGACGACACGGTGGAAAAGCTCCCGTCGGTCAACACCAAAGACGGACAAGGAAAG
ACGGATCTACCAGACGAAGGCGACCTCAACGCCCAGTACCAGCGCGAGGTGGCCATCTTTAGCGCAAAGTACAAG
GCCGTCAAGACGAAGCCCACGGCCGCCCAACTCCAAGAGAAGCAACTCGACTACTACCGCGGCGTGCGTACCGGC
GTCGTCCTCATCTGGATGATTACCAACTTTGCCCTCGCCGCCTTGGTCTTGAGCTCGGCGGGGTTGGAGAAGATT
ACTCCCGGTCGAGGAAGCCAGGCGGATGAGGAGACTGCGCGGGCGAACCTCTACATGGCCATCGTGCTCTGGAGC
GTTGCGGCGCTCAGCTCTTTCAAGTTTCTAGGCGCGTTGTGGTTTTTGATTATACGGTTGTTTAGGGGCGTCTGA
Transcript >Ophcf2|06853
ATGTCATACAATCGCCTCGACTATCACGATCCCATGGACCGTCGCGGCCGTCCTTATCGGACGCCTTCTCCTGGC
CAGCCGCTGCAGCAGGGATATCAACTCGACGAAAGCCCCTATGGCCAGCAGCGACTCACCCCCGGTCCACCGAGC
CATCAGCGTCTCGGCACCCCGAGCGACCAACTCAATATACATGCTGCGTCCACCGTCGAACACCTCCCTTACTCG
GGCTCAAGAGGCTATGGCGACGCCGTCGTCAACCCACAGCTCCTCCACGACGAATACGGCGGCACGCACCCCAAC
TATCCCTCGCAAGACGGCTACTTTGATCCTCAGACTCACGGATACGAGGTCGACGACCGCCGCCCGATGCTCGAC
TATCACAGCACGCCCGGCTACGACGACCCGTACCATGATCACCCGCAACAACAACAGCAGCAGCAGCAGCAGCAG
CAACTGAGGCGCTGGAAGACGGTCAAGCAGGTCCTGCTCTACCGCGGAAACCTCGTTCTCGACTGTCCCGTGCCG
CCCGTCCTCCTGCAACAGAATCAGCACGGCGAGCGCGACGAGTTTACACACATGCGCTACTCGGCCGCGACCTGC
GATCCTTCCGAGTTTTACAATGAAAATTTTACCCTCCGCCAGCAGTTGTTCAGCAAGCCGCGACACACTGAGCTT
TTCATCGTCATAACCATGTATAACGAAGACGATATTCTGTTTGCCCGCACCCTCATTGGCGTTTTCAAGAACATC
GAGTACATGTGCAACCGACCGAATAGCAAGACTTGGGGGAATGAGGCTTGGAAAAAGATTGTCGTCTGCGTCGTC
AGCGACGGTCGCGCAAAGATTAATCCTCGGACAAAGGCTGTCCTCTCCGGCATGGGCGTCTACCAAGAGGGTATT
GCCAAGCAGCAGGTCAACAACAAGGACGTGACGGCTCATATCTACGAGTACACGACGCAGACGCATCTACAGCTC
AAGAATGACACCGTCGTGCTCGTCCACCGTCGTCGGCCGGTACAGATGATTTTCTGCCTCAAGGAGAAGAATCAG
AAGAAAATAAATTCCCACCGCTGGTTCTTCCAGGCGTTTGGACGCGTCTTGGATCCCAACATTTGCGTCCTTCTC
GACGCCGGAACCCGACCTGGAGGCAACTCCATCTACCACCTCTGGAAAGCCTTTGATCTCGAACCAATGTGCGGC
GGCGCCTGCGGTGAAATCAAGGCCATGCTCGGAACCGGCGGCAAAAACCTCGTCAATCCCCTCGTGGCGACGCAG
AATTTCGAATACAAGATGAGCAACATCCTCGACAAGCCGTTGGAATCCGCCTTTGGCTTCATTTCTGTCCTTCCC
GGCGCCTTTTCCGCCTACCGCTACGTCGCCCTTCAAAACGACAAGAACGGCAAAGGACCGCTGGAAAAGTATTTC
CTCGGCGAGACGCTTCACGGCGGTAGCAACGCCGGTCTCTTCGAATCCAACATGTACCTCGCCGAAGACCGCATC
CTCTGTTTCGAGCTCGTCACCAAGCGCAACTGCCACTGGATCCTGCAGTACGTGAAGTCGGCCAACGGAGAGACG
GACGTCCCAGACACCGTCACCGAGCTGGTGCTGCAGCGACGACGATGGCTCAACGGATCCTTTTTCGCCGCCGTC
TACGCCATTGCTCACTTTCACGAATTCTTCCGCTCCGATCACTCTATCTTTCGCAAGCTCGGCTTCTTCTTCGAG
TTTGTCTTTCAGACCATCAACATGATTTTCGCCTGGTTTGCCATTGGCAACTTTTTCCTCGTCTTCAAAATCCTC
ACCACCAGCCTGGGGTCCCCGGAGCTGCTCGGTAGGGTCGGGGAGATTCTCAGCGTCGTCTTTACCTGGCTGTAC
GGTGTCATTCTGATCACCTGCTTTGTCCTGTCCATGGGCAATCGCCCGGCAGGTTCGGGGAGGCTATACACCGCC
ATGGTCTGGTTCTGGGCCGGCATCATGATCTACCTCCTCTTTGCCGCCGTCTTCATCGCCGTCAAGGCCATCATC
GCCGACCTCAACAACGGCCGACCCTTTAATATCCGGGAAATCTTTACCAACCAAGTCTTTTACACCCTCATCGTC
TCCGTCATGTCCACCTATGGCATCTGGCTCCTCGCCTCGCTGCTGATGTTCGACCCATGGCACATGATTACTTCT
TTCGTCCAATACATGCTGCTGTCGCCGACGTACACCAACGTGCTGAACGTCTACGCCTTTTGCAACACGCACGAC
GTCTCGTGGGGAACAAAAGGCGACGACACGGTGGAAAAGCTCCCGTCGGTCAACACCAAAGACGGACAAGGAAAG
ACGGATCTACCAGACGAAGGCGACCTCAACGCCCAGTACCAGCGCGAGGTGGCCATCTTTAGCGCAAAGTACAAG
GCCGTCAAGACGAAGCCCACGGCCGCCCAACTCCAAGAGAAGCAACTCGACTACTACCGCGGCGTGCGTACCGGC
GTCGTCCTCATCTGGATGATTACCAACTTTGCCCTCGCCGCCTTGGTCTTGAGCTCGGCGGGGTTGGAGAAGATT
ACTCCCGGTCGAGGAAGCCAGGCGGATGAGGAGACTGCGCGGGCGAACCTCTACATGGCCATCGTGCTCTGGAGC
GTTGCGGCGCTCAGCTCTTTCAAGTTTCTAGGCGCGTTGTGGTTTTTGATTATACGGTTGTTTAGGGGCGTCTGA
Gene >Ophcf2|06853
ATGTCATACAATCGCCTCGGTACGTGCGTTGCGACATGCGCCTCCCTGATTCACGGCCTCCCTAGCCTCGTGGCT
TCGCATGCCATTTACATTTAACCTGTCCTCTTCATCACCCCTTTTGCTAATTCGACAGACTATCACGATCCCATG
GACCGTCGCGGCCGTCCTTATCGGACGCCTTCTCCTGGCCAGCCGCTGCAGCAGGGATATCAACTCGACGAAAGC
CCCTATGGCCAGCAGCGACTCACCCCCGGTCCACCGAGCCATCAGCGTCTCGGCACCCCGAGCGACCAACTCAAT
ATACATGCTGCGGTAGGTTGAAGCAACGCGCCGACGCTGCTTTGCTGACGCCCCCCAGTCCACCGTCGAACACCT
CCCTTACTCGGGCTCAAGAGGCTATGGCGACGCCGTCGTCAACCCACAGCTCCTCCACGACGAATACGGCGGCAC
GCACCCCAACTATCCCTCGCAAGACGGCTACTTTGATCCTCAGACTCACGGATACGAGGTCGACGACCGCCGCCC
GATGCTCGACTATCACAGCACGCCCGGCTACGACGACCCGTACCATGATCACCCGCAACAACAACAGCAGCAGCA
GCAGCAGCAGCAACTGAGGCGCTGGAAGACGGTCAAGCAGGTCCTGCTCTACCGCGGAAACCTCGTTCTCGACTG
TCCCGTGCCGCCCGTCCTCCTGCAACAGAATCAGCACGGCGAGCGCGACGAGTTTACACACATGCGCTACTCGGC
CGCGACCTGCGATCCTTCCGAGTTTTACAATGAAAATTTTACCCTCCGCCAGCAGTTGTTCAGCAAGCCGCGACA
CACTGAGCTTTTCATCGTCATAACCATGTATAACGAAGACGATATTCTGTTTGCCCGCACCCTCATTGGCGTTTT
CAAGAACATCGAGTACATGTGCAACCGACCGAATAGCAAGACTTGGGGGAATGAGGCTTGGAAAAAGATTGTCGT
CTGCGTCGTCAGCGACGGTCGCGCAAAGATTAATCCTCGGACAAAGGCTGTCCTCTCCGGCATGGGCGTCTACCA
AGAGGGTATTGCCAAGCAGCAGGTCAACAACAAGGACGTGACGGCTCATATCTACGAGTACACGACGCAGACGCA
TCTACAGCTCAAGAATGACACCGTCGTGCTCGTCCACCGTCGTCGGCCGGTACAGATGATTTTCTGCCTCAAGGA
GAAGAATCAGAAGAAAATAAATTCCCACCGCTGGTTCTTCCAGGCGTTTGGACGCGTCTTGGATCCCAACATTTG
CGTCCTTCTCGACGCCGGAACCCGACCTGGAGGCAACTCCATCTACCACCTCTGGAAAGCCTTTGATCTCGAACC
AATGTGCGGCGGCGCCTGCGGTGAAATCAAGGCCATGCTCGGAACCGGCGGCAAAAACCTCGTCAATCCCCTCGT
GGCGACGCAGAATTTCGAATACAAGATGAGCAACATCCTCGACAAGCCGTTGGAATCCGCCTTTGGCTTCATTTC
TGTCCTTCCCGGCGCCTTTTCCGCCTACCGCTACGTCGCCCTTCAAAACGACAAGAACGGCAAAGGACCGCTGGA
AAAGTATTTCCTCGGCGAGACGCTTCACGGCGGTAGCAACGCCGGTCTCTTCGAATCCAACATGTACCTCGCCGA
AGACCGCATCCTCTGTTTCGAGCTCGTCACCAAGCGCAACTGCCACTGGATCCTGCAGTACGTGAAGTCGGCCAA
CGGAGAGACGGACGTCCCAGACACCGTCACCGAGCTGGTGCTGCAGCGACGACGATGGCTCAACGGATCCTTTTT
CGCCGCCGTCTACGCCATTGCTCACTTTCACGAATTCTTCCGCTCCGATCACTCTATCTTTCGCAAGCTCGGCTT
CTTCTTCGAGTTTGTCTTTCAGACCATCAACATGATTTTCGCCTGGTTTGCCATTGGCAACTTTTTCCTCGTCTT
CAAAATCCTCACCACCAGCCTGGGGTCCCCGGAGCTGCTCGGTAGGGTCGGGGAGATTCTCAGCGTCGTCTTTAC
CTGGCTGTACGGTGTCATTCTGATCACCTGCTTTGTCCTGTCCATGGGCAATCGCCCGGCAGGTTCGGGGAGGCT
ATACACCGCCATGGTCTGGTTCTGGGCCGGCATCATGATGTGAGTACCGCGCAGTGAGTGTGCTGGCAAAAGTCA
GCCGCTAACTTGTTCTCAGCTACCTCCTCTTTGCCGCCGTCTTCATCGCCGTCAAGGCCATCATCGCCGACCTCA
ACAACGGCCGACCCTTTAATATCCGGGAAATCTTTACCAACCAAGTCTTTTACACCCTCATCGTCTCCGTCATGT
CCACCTATGGCATCTGGCTCCTCGCCTCGCTGCTGATGTTCGACCCATGGCACATGATTACTTCTTTCGTCCAAT
ACATGCTGCTGTCGCCGACGTACACCAACGTGCTGAACGTCTACGCCTTTTGCAACACGCACGACGTCTCGTGGG
GAACAAAAGGCGACGACACGGTGGAAAAGCTCCCGTCGGTCAACACCAAAGACGGACAAGGAAAGACGGATCTAC
CAGACGAAGGCGACCTCAACGCCCAGTACCAGCGCGAGGTGGCCATCTTTAGCGCAAAGTACAAGGCCGTCAAGA
CGAAGCCCACGGCCGCCCAACTCCAAGAGAAGCAACTCGACTACTACCGCGGCGTGCGTACCGGCGTCGTCCTCA
TCTGGATGATTACCAACTTTGCCCTCGCCGCCTTGGTCTTGAGCTCGGCGGGGTTGGAGAAGATTACTCCCGGTC
GAGGAAGCCAGGCGGATGAGGAGACTGCGCGGGCGAACCTCTACATGGCCATCGTGCTCTGGAGCGTTGCGGCGC
TCAGCTCTTTCAAGTTTCTAGGCGCGTTGTGGTTTTTGATTATACGGTTGTTTAGGGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail