Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06839
Gene name
Locationscaffold_08:1187331..1193786
Strand+
Gene length (bp)6455
Transcript length (bp)6324
Coding sequence length (bp)6324
Protein length (aa) 2108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13329 ATG2_CAD Autophagy-related protein 2 CAD motif 9.4E-44 1222 1391
PF09333 ATG_C Autophagy-related protein C terminal domain 7.1E-30 2011 2106

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.3641 0.2553 0.1006 0.1964 0.5195 0.0365 0.3886 0.5258 0.4862 0.0276

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup591
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4485
Ophiocordyceps australis map64 (Brazil) OphauB2|5247
Ophiocordyceps australis map64 (Brazil) OphauB2|5248
Ophiocordyceps camponoti-floridani Ophcf2|06839 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3345
Ophiocordyceps kimflemingae Ophio5|5082
Ophiocordyceps subramaniannii Hirsu2|7059
Ophiocordyceps subramaniannii Hirsu2|7060

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06839
MAAYLPSFRSSSMPKRLLRYALSRLDLLDAEALDLDNLELAIGRHTVFEFRDVGVKLKKLDKLLRLPAALQLSRA
KVLLLRVTVPMDFYTSPITVEVDGVQVIVKVDAERDIPHTQPPPTDPVPNTVDLAQSFLDTQPSLERKRLEEALV
VETQDLAASVATTDDGEDEDALGTGQPLSLPVFLADFLQGIVDRTQVSIKHVSFQLDMLVPTTDANPSQNTLEPV
SFQIALEAIQVEGVTTTAETPSGPTPSDDQPGFVPKPGKRHISLANVRAYLISETNVFSSLSRSPSDAASSPIMT
RNAPSRTSSSLSQGSFREQPMASLQEGFRERLSDRDNSSDDENLGDSEVALAIPYEFDDETPATPRAQASLYGSD
MFGESVFHPTLESPPHDAQRQPRDSAEHQPRGSEEIQPHDSGGLQPSEDPAELQVDESVPGSTHGLLSPLLTRQP
ETSVTSPAHDRSVEDLTESHLYTHEEAESMYMSAFSSTQRERESMAGASLMSEQHREAPTSPEQSPPPPPAEDSS
SPRRAMPGAWDEESESSACRTKGLDTGTRPQSPSVTTSSDAADEFPDRDDAPTPRGPSRVVKKIMSLDAVSIYLP
QLRQNPVQGAVPLQMRSMANPICSDAPGIDPDSHGRPGARADTPDEDAVEIVLSPLTVDFDASLGILLATAIGGL
LKAVEREEPVGKRPAKDTSVPRLVILARDISLNLVNHVRGVTDTSGWQLNPSSLAYQDEELLLNATLQNLRVCVA
PTRCGPSDRTAEDGSVTRIDLERFRFGYADGDMVSFDCGRPMTTSVRDTFLSGGHDVAVKIVRSANSTVIDVETL
PLVVQLDLQRLDETLGWFGGLSSFLNLSSSRTGSPPPPPPPTSQPQPLVKSKPVVRFEAAAQVRGGRPEQHRPVV
RNKINVRIGGALVELAGRECSVAAESNAIKMVGRDQGIGIACGRIRVSGPYSLRTRGDPDQSPPASAEVGGLRLE
LSPVPEDGDLDKLLELIIPSRTKFDDGDDGEIMVDTLLRQRRKGSVLRVTMETVKVRMANPALLVPALPKLGDEV
AKLTTTVAAKYLPEDDRPGILTLTKIHQLAVSIDVGGRLGLVESQMDDLEVAHITVPSLVAVAIRRVSVRRNGSE
QLVSSDAPEEDETPVVMARIIGDEMEPTIKLKLRNLRMEYRVPTVMDALGLDEETTPRDFEASLATSVASLADQS
FFKPGRDVEGRKADGQPPTVLDIGLRDCLVGLNPLNLASKLFVVLTDARVQAVVPSDATTTTTTTTTTTTTVNVK
KASLLLIDDDVFSEAAGTGSRTESRRHGRHSSASASPQVADLCARGFVDICYISSASVVATVKPVDETTADKQVD
VELRDDLLVLETCADSTQTLIALANGLKPPMPSSKEDKYRTRVVPVQDLLASISAEAFGKPEGDYDFDQDFAGAQ
ELAGSELTGGYDDRHGLAGSRYEESLVGEELFDATARPDEAMMEDTAEGVLLSSFRGEAVEDQGDGEKLVIHDDF
YSLDAGGGEKHKAKLWNPVKNTYDRAPDVLVGRSPLRLSVRDVHVIWNLFDGYDWSRTRDVIAKAVEDVEARATE
RQQRRQQTADAYDEEEEEETIGDFLFNSIYIGIPTNRDPRELTRDINAGLNADEDTVTETESVATASTVRTASQR
QPSGTVRHRRRRLRLNRSRRHKITFELRGVNADVVAYPGSPRPTATTRGQETLSSIDVRVQTLDIFDHVPTSTWK
KFATYDQDQGEREMGTNMVHVELLNVRPIPDLAASEIVMRATVLPLRLHVDQDALDFITRFFEFKDERGPGPTTS
PAGDVPFLQRAEVFDIPVKLDFKPKRVDYAGLRCGHTTEFMNFIVLQEARMVLRHVIVYGVSGFDRLGKTLNDIW
TPDVRRNQLPGVVAGLAPVRSLVNIGSGFRDLVEIPVREYRKDGRVVRSVSKGAAAFARTTGTELVKLGAKIAVG
TQYALQGAEEMLGQQEASQQRAADDGGDGHDDDGGDDDDGDDLDDDDDDDDDLDHRDAKQISLYAHQPTGVLQGI
RGGYRSLTRDVNLARDAIIAVPGEVLDSRTAGGAARAVLRRAPTIIFRPVVGVTKAIGQTLMGATNTIDPQNRRR
IDEKYKH*
Coding >Ophcf2|06839
ATGGCCGCCTATCTCCCCTCGTTTAGGAGTTCCAGCATGCCCAAGAGGCTGCTGCGATATGCCCTCTCCCGTCTC
GACCTCCTCGACGCCGAGGCCCTGGACTTGGATAACCTCGAGCTCGCCATAGGCCGCCACACCGTCTTTGAGTTT
CGAGATGTTGGCGTCAAGCTCAAGAAACTCGACAAGCTGCTGCGACTCCCTGCCGCCCTCCAACTCTCCCGCGCC
AAAGTCCTGCTACTGAGGGTCACCGTCCCCATGGACTTCTATACCAGTCCTATAACCGTCGAGGTCGATGGGGTC
CAAGTCATCGTCAAGGTCGACGCCGAACGCGATATCCCGCACACGCAGCCGCCCCCCACCGACCCGGTCCCCAAC
ACGGTCGACTTGGCTCAGTCCTTTCTCGATACACAGCCCTCGCTCGAGAGGAAGCGGCTGGAGGAGGCTCTCGTC
GTCGAAACGCAGGACCTCGCCGCTTCCGTTGCCACAACCGACGATGGCGAAGACGAGGACGCGTTGGGCACCGGC
CAGCCCCTTTCTCTCCCCGTGTTTCTCGCAGACTTTTTACAGGGCATCGTCGACCGCACTCAAGTGAGCATCAAG
CACGTCAGCTTTCAGCTCGACATGCTCGTTCCGACCACCGATGCGAACCCGTCACAGAACACCCTTGAGCCTGTT
TCCTTTCAGATTGCCCTCGAAGCCATCCAGGTCGAGGGCGTCACCACCACCGCCGAGACCCCGTCGGGCCCGACG
CCATCTGACGACCAGCCAGGCTTTGTTCCCAAGCCGGGGAAGCGTCACATATCCCTCGCCAACGTGCGCGCATAC
CTCATTTCCGAAACCAACGTCTTTTCCTCGCTCTCGCGCTCGCCTTCCGACGCCGCTTCGTCGCCAATCATGACG
CGAAACGCCCCCTCACGCACGTCTTCTTCCCTGTCACAGGGGAGCTTCCGCGAGCAGCCCATGGCCTCGTTGCAA
GAGGGCTTCCGTGAACGTCTGTCTGACCGCGACAACTCCTCGGACGACGAGAACTTGGGAGACAGCGAGGTGGCC
TTGGCCATTCCATACGAGTTTGACGACGAGACACCTGCCACGCCGCGAGCTCAGGCCTCCCTGTATGGATCTGAC
ATGTTCGGAGAGTCCGTCTTTCATCCGACCCTGGAATCGCCGCCTCACGATGCACAGCGACAGCCGCGGGATTCG
GCAGAGCATCAGCCTCGTGGTTCTGAAGAGATACAGCCCCACGATTCAGGAGGACTGCAGCCGTCCGAGGACCCG
GCAGAGCTACAAGTGGACGAGTCCGTTCCGGGCTCTACTCATGGGCTACTGTCGCCACTGCTGACGCGCCAACCA
GAGACGTCTGTCACCTCTCCGGCACACGACCGCTCCGTGGAAGACTTGACCGAGTCGCATCTATACACCCACGAA
GAAGCCGAGAGCATGTACATGAGCGCTTTTTCCTCCACTCAACGGGAACGGGAATCGATGGCTGGCGCCTCTCTC
ATGTCAGAGCAGCATCGGGAGGCTCCGACCTCGCCGGAGCAGTCGCCGCCGCCGCCCCCGGCCGAAGATTCGAGC
AGCCCGAGACGAGCCATGCCCGGAGCCTGGGACGAAGAGTCTGAAAGTTCTGCCTGTCGCACAAAAGGGTTGGAT
ACGGGGACTCGACCTCAGAGTCCCTCGGTAACTACCTCCTCCGATGCTGCTGATGAATTCCCGGATCGGGACGAC
GCGCCCACGCCGAGAGGACCGTCGCGAGTCGTCAAGAAAATCATGTCGCTCGACGCCGTGTCAATCTACCTCCCT
CAGCTTCGGCAGAACCCAGTACAAGGTGCGGTGCCGCTTCAGATGCGGTCAATGGCCAATCCTATCTGCTCTGAT
GCACCTGGGATAGACCCTGACTCTCATGGCCGGCCCGGAGCACGAGCCGACACGCCAGACGAAGACGCGGTCGAG
ATTGTTCTCTCGCCCCTGACGGTTGACTTTGACGCCTCTTTAGGAATCCTGCTGGCCACGGCCATCGGTGGCCTG
CTCAAGGCCGTAGAGCGCGAGGAGCCCGTAGGGAAGCGGCCTGCGAAAGACACCAGCGTGCCCCGGCTCGTCATC
CTAGCCCGGGATATTTCGCTCAACCTTGTCAATCATGTGAGGGGTGTTACAGACACGTCTGGCTGGCAGTTGAAT
CCTTCCTCTTTGGCCTACCAGGACGAGGAGCTTTTACTAAACGCCACCTTGCAGAACTTGCGTGTCTGCGTGGCG
CCCACGCGATGCGGCCCGAGCGACCGGACAGCGGAGGATGGCTCCGTCACCAGGATAGACCTCGAGCGGTTCCGG
TTCGGCTATGCCGACGGCGACATGGTTTCCTTTGACTGCGGGCGGCCGATGACGACGTCGGTGAGAGACACCTTT
CTCAGCGGCGGACACGATGTTGCCGTCAAGATCGTTCGGTCGGCCAACTCGACCGTCATCGACGTGGAGACGCTC
CCCCTGGTTGTGCAGCTCGACTTGCAGAGGCTGGACGAGACGCTGGGCTGGTTCGGGGGGCTCAGCAGCTTCCTC
AACTTGTCGTCCTCGCGCACCGGTTCGCCGCCGCCGCCGCCGCCGCCAACTTCCCAGCCTCAGCCTCTTGTCAAG
TCGAAGCCCGTCGTCCGCTTCGAAGCAGCCGCACAGGTCCGAGGCGGTCGTCCGGAACAGCATCGTCCAGTCGTG
AGGAACAAGATCAATGTGCGTATCGGGGGCGCCTTGGTTGAACTCGCCGGCAGGGAATGCAGCGTGGCGGCAGAG
AGCAACGCCATCAAGATGGTCGGGCGGGATCAGGGCATCGGCATCGCCTGCGGTCGCATCCGCGTCTCCGGTCCT
TATAGTCTGCGCACTCGTGGTGACCCCGACCAGTCCCCCCCCGCCTCGGCCGAGGTCGGTGGCCTCCGGCTGGAG
CTCTCTCCGGTCCCGGAAGACGGCGACTTGGACAAGCTGTTGGAGCTCATCATTCCCTCGAGGACCAAGTTCGAC
GACGGCGACGATGGTGAGATCATGGTCGATACCCTCTTGCGTCAGCGGCGAAAGGGCTCCGTTCTCAGGGTCACG
ATGGAGACGGTCAAGGTCAGGATGGCGAACCCGGCGCTCCTGGTGCCGGCGCTTCCCAAGTTGGGAGACGAGGTG
GCCAAGCTGACGACGACGGTGGCGGCCAAATATCTCCCCGAAGACGACCGTCCCGGCATCCTGACCCTGACCAAG
ATCCATCAGCTGGCCGTGAGCATCGACGTCGGGGGCAGGCTCGGGCTGGTGGAGAGCCAGATGGACGATCTCGAG
GTGGCCCATATAACCGTTCCGTCGCTCGTCGCCGTCGCCATCCGTCGGGTCTCGGTCCGACGCAACGGATCTGAG
CAGCTCGTTTCCTCGGACGCGCCGGAGGAAGACGAGACACCGGTCGTCATGGCGAGGATCATCGGGGACGAGATG
GAGCCGACGATCAAGCTGAAGCTGCGGAATCTGCGGATGGAGTACCGCGTGCCGACCGTCATGGACGCCTTGGGC
CTTGATGAGGAGACGACGCCTCGGGACTTTGAGGCCAGCCTTGCGACGTCGGTTGCCAGCCTGGCCGATCAATCA
TTCTTCAAGCCCGGCCGCGATGTCGAGGGACGGAAGGCGGACGGCCAGCCACCGACGGTGCTCGACATTGGGTTG
CGCGATTGCCTCGTCGGGCTCAATCCCTTGAACCTGGCATCTAAGCTGTTTGTCGTGCTCACGGACGCGCGCGTA
CAGGCCGTCGTGCCCTCGGACGCGACGACGACGACGACGACGACGACGACGACGACGACGACGGTCAATGTCAAA
AAGGCATCTCTGCTGCTGATTGACGACGACGTTTTTTCCGAGGCCGCCGGCACCGGGTCACGGACCGAGTCACGG
AGACACGGGCGGCATTCTTCGGCATCGGCGTCCCCTCAGGTGGCCGACTTGTGCGCCAGGGGCTTTGTCGACATT
TGCTACATCTCGTCTGCCAGCGTCGTCGCCACGGTCAAGCCGGTCGACGAGACGACGGCCGACAAGCAGGTCGAC
GTCGAGCTTCGGGATGACCTGCTGGTGCTGGAGACGTGCGCCGACTCGACCCAGACGTTGATTGCGCTGGCGAAC
GGGCTGAAGCCGCCAATGCCGTCGAGCAAGGAAGACAAGTACCGCACGAGGGTGGTCCCGGTGCAGGATCTCTTG
GCCTCCATCTCGGCCGAGGCCTTTGGCAAGCCAGAAGGTGACTACGACTTTGACCAGGATTTCGCCGGGGCCCAG
GAATTGGCCGGCAGCGAGTTGACCGGCGGCTACGACGACCGGCATGGACTGGCAGGCTCTCGATACGAAGAGTCG
CTCGTCGGCGAGGAGCTCTTCGACGCCACGGCTCGCCCGGACGAGGCCATGATGGAGGACACGGCCGAGGGCGTT
TTGCTCTCGTCTTTTCGCGGCGAGGCCGTCGAGGACCAAGGTGACGGTGAGAAGCTCGTCATTCACGATGACTTT
TATAGCCTCGACGCCGGCGGCGGAGAGAAGCACAAGGCCAAGCTGTGGAACCCGGTCAAGAACACGTACGACCGG
GCCCCGGACGTGCTCGTCGGACGCAGTCCGTTGAGGTTGTCGGTCCGGGACGTACACGTCATCTGGAACCTCTTT
GACGGTTACGACTGGAGCCGAACCCGCGACGTCATCGCCAAGGCAGTCGAGGACGTCGAGGCCAGGGCGACGGAG
CGGCAGCAGAGACGACAGCAGACGGCGGACGCGTACGACGAGGAGGAGGAAGAGGAGACGATTGGCGACTTTCTC
TTCAACTCCATCTACATCGGCATTCCCACCAATCGCGACCCCCGCGAGCTGACGCGCGATATCAACGCAGGCCTC
AACGCCGACGAGGACACGGTGACGGAGACGGAGTCCGTGGCGACGGCTTCGACGGTCAGGACGGCGTCGCAACGG
CAACCGTCCGGGACGGTCCGCCATCGGAGACGCCGGCTCCGGCTCAACCGAAGCCGGCGGCACAAGATCACCTTT
GAGCTCAGGGGCGTCAATGCCGACGTGGTGGCCTACCCTGGCTCGCCCAGACCGACGGCGACGACCCGAGGCCAG
GAGACGCTGAGCAGCATCGACGTCAGGGTCCAGACGCTCGACATCTTCGACCACGTGCCGACGTCGACGTGGAAG
AAGTTTGCCACGTACGACCAGGACCAGGGCGAGCGCGAGATGGGCACTAACATGGTCCACGTCGAGCTGCTCAAC
GTTCGGCCGATACCGGACCTGGCGGCGTCGGAGATTGTCATGAGAGCGACGGTCCTGCCGCTGAGGCTTCACGTG
GACCAGGACGCGCTGGATTTTATAACGCGCTTCTTCGAGTTCAAGGATGAGAGAGGTCCGGGGCCGACGACTTCA
CCGGCCGGAGACGTTCCCTTCCTTCAGCGCGCCGAGGTGTTTGACATTCCCGTCAAGCTCGACTTTAAGCCGAAA
CGGGTCGATTACGCAGGTCTGAGATGCGGTCACACGACCGAGTTTATGAACTTCATCGTGCTCCAAGAGGCTCGC
ATGGTGCTGCGTCACGTCATCGTCTACGGCGTCTCCGGTTTCGACAGACTAGGCAAGACGCTCAACGACATCTGG
ACGCCCGATGTCCGGCGCAACCAGCTTCCGGGCGTCGTCGCGGGCCTGGCGCCGGTCCGATCCCTCGTCAACATC
GGCAGCGGCTTCCGGGATCTGGTGGAGATTCCCGTCCGTGAGTATCGCAAGGATGGGCGCGTCGTCCGCAGCGTC
TCCAAGGGTGCGGCTGCCTTTGCCCGCACGACGGGCACAGAACTGGTCAAGCTGGGCGCCAAGATTGCCGTCGGC
ACCCAGTACGCACTGCAGGGCGCCGAGGAGATGTTGGGTCAGCAGGAGGCGTCTCAACAGCGTGCTGCTGATGAT
GGTGGTGACGGCCATGACGACGACGGCGGCGACGACGACGACGGCGACGACCTCGACGACGACGACGACGACGAC
GACGACCTCGACCACCGAGACGCCAAGCAAATCTCGCTCTACGCCCATCAGCCTACGGGCGTGCTTCAGGGCATC
CGCGGCGGATACCGATCGCTGACGCGCGACGTCAACCTCGCCCGAGACGCCATCATCGCCGTACCCGGCGAAGTG
CTCGACAGCCGGACCGCCGGCGGCGCGGCCCGAGCGGTACTGAGGAGAGCGCCCACCATCATCTTCCGGCCGGTT
GTGGGCGTGACGAAGGCCATCGGACAGACGCTGATGGGGGCGACGAATACGATTGATCCGCAGAACCGGAGGCGG
ATAGACGAGAAATACAAGCACTGA
Transcript >Ophcf2|06839
ATGGCCGCCTATCTCCCCTCGTTTAGGAGTTCCAGCATGCCCAAGAGGCTGCTGCGATATGCCCTCTCCCGTCTC
GACCTCCTCGACGCCGAGGCCCTGGACTTGGATAACCTCGAGCTCGCCATAGGCCGCCACACCGTCTTTGAGTTT
CGAGATGTTGGCGTCAAGCTCAAGAAACTCGACAAGCTGCTGCGACTCCCTGCCGCCCTCCAACTCTCCCGCGCC
AAAGTCCTGCTACTGAGGGTCACCGTCCCCATGGACTTCTATACCAGTCCTATAACCGTCGAGGTCGATGGGGTC
CAAGTCATCGTCAAGGTCGACGCCGAACGCGATATCCCGCACACGCAGCCGCCCCCCACCGACCCGGTCCCCAAC
ACGGTCGACTTGGCTCAGTCCTTTCTCGATACACAGCCCTCGCTCGAGAGGAAGCGGCTGGAGGAGGCTCTCGTC
GTCGAAACGCAGGACCTCGCCGCTTCCGTTGCCACAACCGACGATGGCGAAGACGAGGACGCGTTGGGCACCGGC
CAGCCCCTTTCTCTCCCCGTGTTTCTCGCAGACTTTTTACAGGGCATCGTCGACCGCACTCAAGTGAGCATCAAG
CACGTCAGCTTTCAGCTCGACATGCTCGTTCCGACCACCGATGCGAACCCGTCACAGAACACCCTTGAGCCTGTT
TCCTTTCAGATTGCCCTCGAAGCCATCCAGGTCGAGGGCGTCACCACCACCGCCGAGACCCCGTCGGGCCCGACG
CCATCTGACGACCAGCCAGGCTTTGTTCCCAAGCCGGGGAAGCGTCACATATCCCTCGCCAACGTGCGCGCATAC
CTCATTTCCGAAACCAACGTCTTTTCCTCGCTCTCGCGCTCGCCTTCCGACGCCGCTTCGTCGCCAATCATGACG
CGAAACGCCCCCTCACGCACGTCTTCTTCCCTGTCACAGGGGAGCTTCCGCGAGCAGCCCATGGCCTCGTTGCAA
GAGGGCTTCCGTGAACGTCTGTCTGACCGCGACAACTCCTCGGACGACGAGAACTTGGGAGACAGCGAGGTGGCC
TTGGCCATTCCATACGAGTTTGACGACGAGACACCTGCCACGCCGCGAGCTCAGGCCTCCCTGTATGGATCTGAC
ATGTTCGGAGAGTCCGTCTTTCATCCGACCCTGGAATCGCCGCCTCACGATGCACAGCGACAGCCGCGGGATTCG
GCAGAGCATCAGCCTCGTGGTTCTGAAGAGATACAGCCCCACGATTCAGGAGGACTGCAGCCGTCCGAGGACCCG
GCAGAGCTACAAGTGGACGAGTCCGTTCCGGGCTCTACTCATGGGCTACTGTCGCCACTGCTGACGCGCCAACCA
GAGACGTCTGTCACCTCTCCGGCACACGACCGCTCCGTGGAAGACTTGACCGAGTCGCATCTATACACCCACGAA
GAAGCCGAGAGCATGTACATGAGCGCTTTTTCCTCCACTCAACGGGAACGGGAATCGATGGCTGGCGCCTCTCTC
ATGTCAGAGCAGCATCGGGAGGCTCCGACCTCGCCGGAGCAGTCGCCGCCGCCGCCCCCGGCCGAAGATTCGAGC
AGCCCGAGACGAGCCATGCCCGGAGCCTGGGACGAAGAGTCTGAAAGTTCTGCCTGTCGCACAAAAGGGTTGGAT
ACGGGGACTCGACCTCAGAGTCCCTCGGTAACTACCTCCTCCGATGCTGCTGATGAATTCCCGGATCGGGACGAC
GCGCCCACGCCGAGAGGACCGTCGCGAGTCGTCAAGAAAATCATGTCGCTCGACGCCGTGTCAATCTACCTCCCT
CAGCTTCGGCAGAACCCAGTACAAGGTGCGGTGCCGCTTCAGATGCGGTCAATGGCCAATCCTATCTGCTCTGAT
GCACCTGGGATAGACCCTGACTCTCATGGCCGGCCCGGAGCACGAGCCGACACGCCAGACGAAGACGCGGTCGAG
ATTGTTCTCTCGCCCCTGACGGTTGACTTTGACGCCTCTTTAGGAATCCTGCTGGCCACGGCCATCGGTGGCCTG
CTCAAGGCCGTAGAGCGCGAGGAGCCCGTAGGGAAGCGGCCTGCGAAAGACACCAGCGTGCCCCGGCTCGTCATC
CTAGCCCGGGATATTTCGCTCAACCTTGTCAATCATGTGAGGGGTGTTACAGACACGTCTGGCTGGCAGTTGAAT
CCTTCCTCTTTGGCCTACCAGGACGAGGAGCTTTTACTAAACGCCACCTTGCAGAACTTGCGTGTCTGCGTGGCG
CCCACGCGATGCGGCCCGAGCGACCGGACAGCGGAGGATGGCTCCGTCACCAGGATAGACCTCGAGCGGTTCCGG
TTCGGCTATGCCGACGGCGACATGGTTTCCTTTGACTGCGGGCGGCCGATGACGACGTCGGTGAGAGACACCTTT
CTCAGCGGCGGACACGATGTTGCCGTCAAGATCGTTCGGTCGGCCAACTCGACCGTCATCGACGTGGAGACGCTC
CCCCTGGTTGTGCAGCTCGACTTGCAGAGGCTGGACGAGACGCTGGGCTGGTTCGGGGGGCTCAGCAGCTTCCTC
AACTTGTCGTCCTCGCGCACCGGTTCGCCGCCGCCGCCGCCGCCGCCAACTTCCCAGCCTCAGCCTCTTGTCAAG
TCGAAGCCCGTCGTCCGCTTCGAAGCAGCCGCACAGGTCCGAGGCGGTCGTCCGGAACAGCATCGTCCAGTCGTG
AGGAACAAGATCAATGTGCGTATCGGGGGCGCCTTGGTTGAACTCGCCGGCAGGGAATGCAGCGTGGCGGCAGAG
AGCAACGCCATCAAGATGGTCGGGCGGGATCAGGGCATCGGCATCGCCTGCGGTCGCATCCGCGTCTCCGGTCCT
TATAGTCTGCGCACTCGTGGTGACCCCGACCAGTCCCCCCCCGCCTCGGCCGAGGTCGGTGGCCTCCGGCTGGAG
CTCTCTCCGGTCCCGGAAGACGGCGACTTGGACAAGCTGTTGGAGCTCATCATTCCCTCGAGGACCAAGTTCGAC
GACGGCGACGATGGTGAGATCATGGTCGATACCCTCTTGCGTCAGCGGCGAAAGGGCTCCGTTCTCAGGGTCACG
ATGGAGACGGTCAAGGTCAGGATGGCGAACCCGGCGCTCCTGGTGCCGGCGCTTCCCAAGTTGGGAGACGAGGTG
GCCAAGCTGACGACGACGGTGGCGGCCAAATATCTCCCCGAAGACGACCGTCCCGGCATCCTGACCCTGACCAAG
ATCCATCAGCTGGCCGTGAGCATCGACGTCGGGGGCAGGCTCGGGCTGGTGGAGAGCCAGATGGACGATCTCGAG
GTGGCCCATATAACCGTTCCGTCGCTCGTCGCCGTCGCCATCCGTCGGGTCTCGGTCCGACGCAACGGATCTGAG
CAGCTCGTTTCCTCGGACGCGCCGGAGGAAGACGAGACACCGGTCGTCATGGCGAGGATCATCGGGGACGAGATG
GAGCCGACGATCAAGCTGAAGCTGCGGAATCTGCGGATGGAGTACCGCGTGCCGACCGTCATGGACGCCTTGGGC
CTTGATGAGGAGACGACGCCTCGGGACTTTGAGGCCAGCCTTGCGACGTCGGTTGCCAGCCTGGCCGATCAATCA
TTCTTCAAGCCCGGCCGCGATGTCGAGGGACGGAAGGCGGACGGCCAGCCACCGACGGTGCTCGACATTGGGTTG
CGCGATTGCCTCGTCGGGCTCAATCCCTTGAACCTGGCATCTAAGCTGTTTGTCGTGCTCACGGACGCGCGCGTA
CAGGCCGTCGTGCCCTCGGACGCGACGACGACGACGACGACGACGACGACGACGACGACGACGGTCAATGTCAAA
AAGGCATCTCTGCTGCTGATTGACGACGACGTTTTTTCCGAGGCCGCCGGCACCGGGTCACGGACCGAGTCACGG
AGACACGGGCGGCATTCTTCGGCATCGGCGTCCCCTCAGGTGGCCGACTTGTGCGCCAGGGGCTTTGTCGACATT
TGCTACATCTCGTCTGCCAGCGTCGTCGCCACGGTCAAGCCGGTCGACGAGACGACGGCCGACAAGCAGGTCGAC
GTCGAGCTTCGGGATGACCTGCTGGTGCTGGAGACGTGCGCCGACTCGACCCAGACGTTGATTGCGCTGGCGAAC
GGGCTGAAGCCGCCAATGCCGTCGAGCAAGGAAGACAAGTACCGCACGAGGGTGGTCCCGGTGCAGGATCTCTTG
GCCTCCATCTCGGCCGAGGCCTTTGGCAAGCCAGAAGGTGACTACGACTTTGACCAGGATTTCGCCGGGGCCCAG
GAATTGGCCGGCAGCGAGTTGACCGGCGGCTACGACGACCGGCATGGACTGGCAGGCTCTCGATACGAAGAGTCG
CTCGTCGGCGAGGAGCTCTTCGACGCCACGGCTCGCCCGGACGAGGCCATGATGGAGGACACGGCCGAGGGCGTT
TTGCTCTCGTCTTTTCGCGGCGAGGCCGTCGAGGACCAAGGTGACGGTGAGAAGCTCGTCATTCACGATGACTTT
TATAGCCTCGACGCCGGCGGCGGAGAGAAGCACAAGGCCAAGCTGTGGAACCCGGTCAAGAACACGTACGACCGG
GCCCCGGACGTGCTCGTCGGACGCAGTCCGTTGAGGTTGTCGGTCCGGGACGTACACGTCATCTGGAACCTCTTT
GACGGTTACGACTGGAGCCGAACCCGCGACGTCATCGCCAAGGCAGTCGAGGACGTCGAGGCCAGGGCGACGGAG
CGGCAGCAGAGACGACAGCAGACGGCGGACGCGTACGACGAGGAGGAGGAAGAGGAGACGATTGGCGACTTTCTC
TTCAACTCCATCTACATCGGCATTCCCACCAATCGCGACCCCCGCGAGCTGACGCGCGATATCAACGCAGGCCTC
AACGCCGACGAGGACACGGTGACGGAGACGGAGTCCGTGGCGACGGCTTCGACGGTCAGGACGGCGTCGCAACGG
CAACCGTCCGGGACGGTCCGCCATCGGAGACGCCGGCTCCGGCTCAACCGAAGCCGGCGGCACAAGATCACCTTT
GAGCTCAGGGGCGTCAATGCCGACGTGGTGGCCTACCCTGGCTCGCCCAGACCGACGGCGACGACCCGAGGCCAG
GAGACGCTGAGCAGCATCGACGTCAGGGTCCAGACGCTCGACATCTTCGACCACGTGCCGACGTCGACGTGGAAG
AAGTTTGCCACGTACGACCAGGACCAGGGCGAGCGCGAGATGGGCACTAACATGGTCCACGTCGAGCTGCTCAAC
GTTCGGCCGATACCGGACCTGGCGGCGTCGGAGATTGTCATGAGAGCGACGGTCCTGCCGCTGAGGCTTCACGTG
GACCAGGACGCGCTGGATTTTATAACGCGCTTCTTCGAGTTCAAGGATGAGAGAGGTCCGGGGCCGACGACTTCA
CCGGCCGGAGACGTTCCCTTCCTTCAGCGCGCCGAGGTGTTTGACATTCCCGTCAAGCTCGACTTTAAGCCGAAA
CGGGTCGATTACGCAGGTCTGAGATGCGGTCACACGACCGAGTTTATGAACTTCATCGTGCTCCAAGAGGCTCGC
ATGGTGCTGCGTCACGTCATCGTCTACGGCGTCTCCGGTTTCGACAGACTAGGCAAGACGCTCAACGACATCTGG
ACGCCCGATGTCCGGCGCAACCAGCTTCCGGGCGTCGTCGCGGGCCTGGCGCCGGTCCGATCCCTCGTCAACATC
GGCAGCGGCTTCCGGGATCTGGTGGAGATTCCCGTCCGTGAGTATCGCAAGGATGGGCGCGTCGTCCGCAGCGTC
TCCAAGGGTGCGGCTGCCTTTGCCCGCACGACGGGCACAGAACTGGTCAAGCTGGGCGCCAAGATTGCCGTCGGC
ACCCAGTACGCACTGCAGGGCGCCGAGGAGATGTTGGGTCAGCAGGAGGCGTCTCAACAGCGTGCTGCTGATGAT
GGTGGTGACGGCCATGACGACGACGGCGGCGACGACGACGACGGCGACGACCTCGACGACGACGACGACGACGAC
GACGACCTCGACCACCGAGACGCCAAGCAAATCTCGCTCTACGCCCATCAGCCTACGGGCGTGCTTCAGGGCATC
CGCGGCGGATACCGATCGCTGACGCGCGACGTCAACCTCGCCCGAGACGCCATCATCGCCGTACCCGGCGAAGTG
CTCGACAGCCGGACCGCCGGCGGCGCGGCCCGAGCGGTACTGAGGAGAGCGCCCACCATCATCTTCCGGCCGGTT
GTGGGCGTGACGAAGGCCATCGGACAGACGCTGATGGGGGCGACGAATACGATTGATCCGCAGAACCGGAGGCGG
ATAGACGAGAAATACAAGCACTGA
Gene >Ophcf2|06839
ATGGCCGCCTATCTCCCCTCGTTTAGGAGTTCCAGCATGCCCAAGAGGCTGCTGCGATATGCCCTCTCCCGTCTC
GACCTCCTCGACGCCGAGGCCCTGGACTTGGATAACCTCGAGCTCGCCATAGGCCGCCACACCGTCTTTGAGTTT
CGAGATGTTGGCGTCAAGCTCAAGGTTCGTGCTCATGTATCCCTTGGAAACCGACTTCACCTTTTGCTGACTCGC
TGCCTAGAAACTCGACAAGCTGCTGCGACTCCCTGCCGCCCTCCAACTCTCCCGCGCCAAAGTCCTGCTACTGAG
GGTCACCGTCCCCATGGACTTCTATACCAGTCCTATAACCGTCGAGGTCGATGGGGTCCAAGTCATCGTCAAGGT
CGACGCCGAACGCGATATCCCGCACACGCAGCCGCCCCCCACCGACCCGGTCCCCAACACGGTCGACTTGGCTCA
GTCCTTTCTCGATACACAGCCCTCGCTCGAGAGGAAGCGGCTGGAGGAGGCTCTCGTCGTCGAAACGCAGGACCT
CGCCGCTTCCGTTGCCACAACCGACGATGGCGAAGACGAGGACGCGTTGGGCACCGGCCAGCCCCTTTCTCTCCC
CGTGTTTCTCGCAGACTTTTTACAGGGCATCGTCGACCGCACTCAAGTGAGCATCAAGCACGTCAGCTTTCAGCT
CGACATGCTCGTTCCGACCACCGATGCGAACCCGTCACAGAACACCCTTGAGCCTGTTTCCTTTCAGATTGCCCT
CGAAGCCATCCAGGTCGAGGGCGTCACCACCACCGCCGAGACCCCGTCGGGCCCGACGCCATCTGACGACCAGCC
AGGCTTTGTTCCCAAGCCGGGGAAGCGTCACATATCCCTCGCCAACGTGCGCGCATACCTCATTTCCGAAACCAA
CGTCTTTTCCTCGCTCTCGCGCTCGCCTTCCGACGCCGCTTCGTCGCCAATCATGACGCGAAACGCCCCCTCACG
CACGTCTTCTTCCCTGTCACAGGGGAGCTTCCGCGAGCAGCCCATGGCCTCGTTGCAAGAGGGCTTCCGTGAACG
TCTGTCTGACCGCGACAACTCCTCGGACGACGAGAACTTGGGAGACAGCGAGGTGGCCTTGGCCATTCCATACGA
GTTTGACGACGAGACACCTGCCACGCCGCGAGCTCAGGCCTCCCTGTATGGATCTGACATGTTCGGAGAGTCCGT
CTTTCATCCGACCCTGGAATCGCCGCCTCACGATGCACAGCGACAGCCGCGGGATTCGGCAGAGCATCAGCCTCG
TGGTTCTGAAGAGATACAGCCCCACGATTCAGGAGGACTGCAGCCGTCCGAGGACCCGGCAGAGCTACAAGTGGA
CGAGTCCGTTCCGGGCTCTACTCATGGGCTACTGTCGCCACTGCTGACGCGCCAACCAGAGACGTCTGTCACCTC
TCCGGCACACGACCGCTCCGTGGAAGACTTGACCGAGTCGCATCTATACACCCACGAAGAAGCCGAGAGCATGTA
CATGAGCGCTTTTTCCTCCACTCAACGGGAACGGGAATCGATGGCTGGCGCCTCTCTCATGTCAGAGCAGCATCG
GGAGGCTCCGACCTCGCCGGAGCAGTCGCCGCCGCCGCCCCCGGCCGAAGATTCGAGCAGCCCGAGACGAGCCAT
GCCCGGAGCCTGGGACGAAGAGTCTGAAAGTTCTGCCTGTCGCACAAAAGGGTTGGATACGGGGACTCGACCTCA
GAGTCCCTCGGTAACTACCTCCTCCGATGCTGCTGATGAATTCCCGGATCGGGACGACGCGCCCACGCCGAGAGG
ACCGTCGCGAGTCGTCAAGAAAATCATGTCGCTCGACGCCGTGTCAATCTACCTCCCTCAGCTTCGGCAGAACCC
AGTACAAGGTGCGGTGCCGCTTCAGATGCGGTCAATGGCCAATCCTATCTGCTCTGATGCACCTGGGATAGACCC
TGACTCTCATGGCCGGCCCGGAGCACGAGCCGACACGCCAGACGAAGACGCGGTCGAGATTGTTCTCTCGCCCCT
GACGGTTGACTTTGACGCCTCTTTAGGAATCCTGCTGGCCACGGCCATCGGTGGCCTGCTCAAGGCCGTAGAGCG
CGAGGAGCCCGTAGGGAAGCGGCCTGCGAAAGACACCAGCGTGCCCCGGCTCGTCATCCTAGCCCGGGATATTTC
GCTCAACCTTGTCAATCATGTGAGGGGTGTTACAGACACGTCTGGCTGGCAGTTGAATCCTTCCTCTTTGGCCTA
CCAGGACGAGGAGCTTTTACTAAACGCCACCTTGCAGAACTTGCGTGTCTGCGTGGCGCCCACGCGATGCGGCCC
GAGCGACCGGACAGCGGAGGATGGCTCCGTCACCAGGATAGACCTCGAGCGGTTCCGGTTCGGCTATGCCGACGG
CGACATGGTTTCCTTTGACTGCGGGCGGCCGATGACGACGTCGGTGAGAGACACCTTTCTCAGCGGCGGACACGA
TGTTGCCGTCAAGATCGTTCGGTCGGCCAACTCGACCGTCATCGACGTGGAGACGCTCCCCCTGGTTGTGCAGCT
CGACTTGCAGAGGCTGGACGAGACGCTGGGCTGGTTCGGGGGGCTCAGCAGCTTCCTCAACTTGTCGTCCTCGCG
CACCGGTTCGCCGCCGCCGCCGCCGCCGCCAACTTCCCAGCCTCAGCCTCTTGTCAAGTCGAAGCCCGTCGTCCG
CTTCGAAGCAGCCGCACAGGTCCGAGGCGGTCGTCCGGAACAGCATCGTCCAGTCGTGAGGAACAAGATCAATGT
GCGTATCGGGGGCGCCTTGGTTGAACTCGCCGGCAGGGAATGCAGCGTGGCGGCAGAGAGCAACGCCATCAAGAT
GGTCGGGCGGGATCAGGGCATCGGCATCGCCTGCGGTCGCATCCGCGTCTCCGGTCCTTATAGTCTGCGCACTCG
TGGTGACCCCGACCAGTCCCCCCCCGCCTCGGCCGAGGTCGGTGGCCTCCGGCTGGAGCTCTCTCCGGTCCCGGA
AGACGGCGACTTGGACAAGCTGTTGGAGCTCATCATTCCCTCGAGGACCAAGTTCGACGACGGCGACGATGGTGA
GATCATGGTCGATACCCTCTTGCGTCAGCGGCGAAAGGGCTCCGTTCTCAGGGTCACGATGGAGACGGTCAAGGT
CAGGATGGCGAACCCGGCGCTCCTGGTGCCGGCGCTTCCCAAGTTGGGAGACGAGGTGGCCAAGCTGACGACGAC
GGTGGCGGCCAAATATCTCCCCGAAGACGACCGTCCCGGCATCCTGACCCTGACCAAGATCCATCAGCTGGCCGT
GAGCATCGACGTCGGGGGCAGGCTCGGGCTGGTGGAGAGCCAGATGGACGATCTCGAGGTGGCCCATATAACCGT
TCCGTCGCTCGTCGCCGTCGCCATCCGTCGGGTCTCGGTCCGACGCAACGGATCTGAGCAGCTCGTTTCCTCGGA
CGCGCCGGAGGAAGACGAGACACCGGTCGTCATGGCGAGGATCATCGGGGACGAGATGGAGCCGACGATCAAGCT
GAAGCTGCGGAATCTGCGGATGGAGTACCGCGTGCCGACCGTCATGGACGCCTTGGGCCTTGATGAGGAGACGAC
GCCTCGGGACTTTGAGGCCAGCCTTGCGACGTCGGTTGCCAGCCTGGCCGATCAATCATTCTTCAAGCCCGGCCG
CGATGTCGAGGGACGGAAGGCGGACGGCCAGCCACCGACGGTGCTCGACATTGGGTTGCGCGATTGCCTCGTCGG
GCTCAATCCCTTGAACCTGGCATCTAAGCTGTTTGTCGTGCTCACGGACGCGCGCGTACAGGCCGTCGTGCCCTC
GGACGCGACGACGACGACGACGACGACGACGACGACGACGACGACGGTCAATGTCAAAAAGGCATCTCTGCTGCT
GATTGACGACGACGTTTTTTCCGAGGCCGCCGGCACCGGGTCACGGACCGAGTCACGGAGACACGGGCGGCATTC
TTCGGCATCGGCGTCCCCTCAGGTGGCCGACTTGTGCGCCAGGGGCTTTGTCGACATTTGCTACATCTCGTCTGC
CAGCGTCGTCGCCACGGTCAAGCCGGTCGACGAGACGACGGCCGACAAGCAGGTCGACGTCGAGCTTCGGGATGA
CCTGCTGGTGCTGGAGACGTGCGCCGACTCGACCCAGACGTTGATTGCGCTGGCGAACGGGCTGAAGCCGCCAAT
GCCGTCGAGCAAGGAAGACAAGTACCGCACGAGGGTGGTCCCGGTGCAGGATCTCTTGGCCTCCATCTCGGCCGA
GGCCTTTGGCAAGCCAGAAGGTGACTACGACTTTGACCAGGATTTCGCCGGGGCCCAGGAATTGGCCGGCAGCGA
GTTGACCGGCGGCTACGACGACCGGCATGGACTGGCAGGCTCTCGATACGAAGAGTCGCTCGTCGGCGAGGAGCT
CTTCGACGCCACGGCTCGCCCGGACGAGGCCATGATGGAGGACACGGCCGAGGGCGTTTTGCTCTCGTCTTTTCG
CGGCGAGGCCGTCGAGGACCAAGGTGACGGTGAGAAGCTCGTCATTCACGATGACTTTTATAGCCTCGACGCCGG
CGGCGGAGAGAAGCACAAGGCCAAGCTGTGGAACCCGGTCAAGAACACGTACGACCGGGCCCCGGACGTGCTCGT
CGGACGCAGTCCGTTGAGGTTGTCGGTCCGGGACGTACACGTCATCTGGAACCTCTTTGACGGTTACGACTGGAG
CCGAACCCGCGACGTCATCGCCAAGGCAGTCGAGGACGTCGAGGCCAGGGCGACGGAGCGGCAGCAGAGACGACA
GCAGACGGCGGACGCGTACGACGAGGAGGAGGAAGAGGAGACGATTGGCGACTTTCTCTTCAACTCCATCTACAT
CGGCATTCCCACCAATCGCGACCCCCGCGAGCTGACGCGCGATATCAACGCAGGCCTCAACGCCGACGAGGACAC
GGTGACGGAGACGGAGTCCGTGGCGACGGCTTCGACGGTCAGGACGGCGTCGCAACGGCAACCGTCCGGGACGGT
CCGCCATCGGAGACGCCGGCTCCGGCTCAACCGAAGCCGGCGGCACAAGATCACCTTTGAGCTCAGGGGCGTCAA
TGCCGACGTGGTGGCCTACCCTGGCTCGCCCAGACCGACGGCGACGACCCGAGGCCAGGAGACGCTGAGCAGCAT
CGACGTCAGGGTCCAGACGCTCGACATCTTCGACCACGTGCCGACGTCGACGTGGAAGAAGTTTGCCACGTACGA
CCAGGACCAGGGCGAGCGCGAGATGGGCACTAACATGGTCCACGTCGAGCTGCTCAACGTTCGGCCGATACCGGA
CCTGGCGGCGTCGGAGATTGTCATGAGAGCGACGGTCCTGCCGCTGAGGCTTCACGTGGACCAGGACGCGCTGGA
TTTTATAACGCGCTTCTTCGAGTTCAAGGATGAGAGAGGTCCGGGGCCGACGACTTCACCGGCCGGAGACGTTCC
CTTCCTTCAGCGCGCCGAGGTGTTTGACATTCCCGTCAAGCTCGACTTTAAGCCGAAACGGGTCGATTACGCAGG
TCTGAGATGCGGTCACACGACCGAGTTTATGAACTTCATCGTGCTCCAAGAGGCTCGCATGGTGCTGCGTCACGT
CATCGTCTACGGCGTCTCCGGTTTCGACAGACTAGGCAAGACGCTCAACGACATCTGGACGCCCGATGTCCGGCG
CAACCAGCTTCCGGGCGTCGTCGCGGGCCTGGCGCCGGTCCGATCCCTCGTCAACATCGGCAGCGGCTTCCGGGA
TCTGGTGGAGATTCCCGTCCGTGAGTATCGCAAGGATGGGCGCGTCGTCCGCAGCGTCTCCAAGGGTGCGGCTGC
CTTTGCCCGCACGACGGGCACAGAACTGGTCAAGCTGGGCGCCAAGATTGCCGTCGGCACCCAGTACGCACTGCA
GGGCGCCGAGGAGATGTTGGGTCAGCAGGAGGCGTCTCAACAGCGTGCTGCTGATGATGGTGGTGACGGCCATGA
CGACGACGGCGGCGACGACGACGACGGCGACGACCTCGACGACGACGACGACGACGACGACGACCTCGACCACCG
AGACGCCAAGCAAATCTCGCTCTACGCCCATCAGCCTACGGGCGTGCTTCAGGGCATCCGCGGCGGATACCGATC
GCTGACGCGCGACGTCAACCTCGCCCGAGACGCCATCATCGCCGTACCCGGCGAAGTGCTCGACAGCCGGACCGC
CGGCGGCGCGGCCCGAGCGGTACTGAGGAGAGCGCCCACCATCATCTTCCGGCCGGTTGTGGGCGTGACGAAGGC
CATCGGACAGACGCTGATGGGGGCGACGAATACGATTGATCCGCAGAACCGGAGGCGGATAGACGAGGTGAGTTT
TTTCCTGTTTACCATGTGTTTGTGTGTGAGACGGTCGAAAGGGGTGTGAGCTAACAAGATTGTAGAAATACAAGC
ACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail