Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06836
Gene name
Locationscaffold_08:1178540..1180632
Strand+
Gene length (bp)2092
Transcript length (bp)2031
Coding sequence length (bp)2031
Protein length (aa) 677

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 7.9E-51 72 442
PF16901 DAO_C C-terminal domain of alpha-glycerophosphate oxidase 2.1E-40 482 602

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide|Peroxisomal targeting signal 0.1483 0.1444 0.1158 0.0356 0.9084 0.1502 0.1835 0.2324 0.2379 0.3822

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4750
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4811
Ophiocordyceps australis 1348a (Ghana) OphauG2|4909
Ophiocordyceps australis map64 (Brazil) OphauB2|643
Ophiocordyceps camponoti-floridani Ophcf2|06836 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1438
Ophiocordyceps kimflemingae Ophio5|5084

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06836
MPPPFSRAIRPLAALVAASGLAATLAFRRQDTPRRDPVSHRDASGRIVPPSFPTLSSRAQQLASLRSGREYDIIV
IGGGATGSGIALDAVTRGLRVALVEGDDFSSGTSSKSTKLVHGGVRYLEKAVWNLDWAQLQLVMEALRERRAFLD
IAPHLSGSLPILLPLQRIWQAPYLWAGCKMYDLLAGSHGLERSYIMGPTRALEACPLLRREGLVGALVYYDGQHN
DSRMNVSLALTAALYGATVVNHVEVVALDKDDTGRVRGVRVRDLMADDNGDDGFIVAGKGVVNATGPFTDAVERM
DDASRKPIVAPASGAHVMLPGSLCPNGMGILDAHSSDGRVVFVLPWQGKTVAGTTDNTCHVEREPVARSDDVDFI
LAAVGRLLGPESAPTRDDVLATWSGIRPLVKDPHAAGKTEALVRSHLVTVSPSGLLTCTGGKWTTYRQMAQDAVD
EAIRVFDLEPRSLTLPDISGQGLEPMTTDGTCRTLRTPVLGSHGYSSDLPAQLMERYGVEADVAHHLSTNYGDRA
WAVLADTRPEATSRLSASFPFVEAEIRYAVRHEAACTAADVIARRLRLSFLDVDEALRALPRVIDIMADELRWLP
SRRDKEWSATVRFLRSMGLAEERLAVTREEVVNGLTGKQTAKQVKNEVCTSSPSSVGVGARTRDDDKAAGELAPE
T*
Coding >Ophcf2|06836
ATGCCCCCCCCCTTCTCTAGGGCTATCCGCCCATTGGCCGCCCTCGTCGCAGCTTCAGGCCTCGCAGCGACTCTC
GCCTTTCGCCGCCAGGATACCCCTAGACGCGACCCTGTCAGCCACCGCGACGCCTCGGGCCGCATCGTGCCACCA
TCGTTCCCTACCCTGTCCTCGCGAGCCCAGCAGCTGGCATCTCTTCGAAGCGGGCGCGAATACGACATCATCGTC
ATCGGAGGCGGAGCGACGGGTTCGGGCATCGCGCTCGACGCGGTAACGCGAGGTCTACGCGTCGCTCTCGTCGAA
GGGGATGACTTTTCGTCGGGAACCAGTTCCAAGAGCACGAAACTGGTGCACGGGGGCGTTCGATACCTGGAAAAG
GCGGTATGGAATCTTGACTGGGCGCAGCTGCAGCTCGTCATGGAGGCCTTGCGCGAGAGGAGGGCTTTTCTCGAT
ATTGCGCCTCATCTGTCTGGATCCTTGCCCATCCTGCTGCCTTTACAGAGGATATGGCAGGCTCCGTACCTGTGG
GCTGGATGCAAGATGTACGACCTGCTGGCGGGCTCGCACGGGCTGGAGAGGTCTTATATCATGGGGCCGACTCGG
GCCCTCGAGGCCTGTCCGCTCCTGAGGAGAGAGGGCTTGGTTGGGGCGCTGGTTTACTACGATGGCCAGCATAAT
GACTCGCGCATGAACGTCTCACTGGCTTTGACGGCTGCGCTGTACGGGGCTACCGTCGTCAATCACGTCGAGGTC
GTGGCCCTGGACAAGGATGATACGGGGAGGGTTCGAGGCGTGCGCGTGAGGGATCTCATGGCTGATGACAATGGT
GACGATGGCTTCATCGTTGCTGGGAAAGGCGTCGTCAACGCTACCGGTCCCTTTACCGATGCCGTCGAGCGGATG
GATGACGCCAGCCGAAAGCCCATCGTCGCCCCGGCATCAGGCGCCCACGTCATGCTACCCGGCTCTCTGTGTCCT
AACGGGATGGGCATCCTCGACGCCCACTCGTCCGACGGCCGCGTCGTCTTCGTCCTCCCCTGGCAGGGAAAGACG
GTGGCTGGCACGACGGACAATACCTGCCATGTTGAACGTGAGCCCGTCGCCCGTTCTGATGATGTCGACTTCATC
CTCGCTGCTGTTGGGAGGTTGTTGGGGCCCGAGTCGGCGCCTACGCGTGACGATGTGCTGGCTACATGGTCTGGT
ATCCGTCCCCTCGTCAAAGATCCCCATGCCGCTGGTAAGACAGAGGCTCTCGTCCGCTCCCACCTCGTCACCGTC
TCGCCATCTGGCCTCCTTACCTGCACAGGCGGCAAGTGGACAACCTACCGCCAGATGGCCCAAGACGCCGTCGAC
GAAGCCATCCGCGTCTTTGACCTCGAGCCGCGCTCCCTCACCCTCCCCGATATAAGCGGCCAGGGCCTCGAGCCC
ATGACCACGGACGGGACCTGTCGCACCCTTCGCACCCCCGTCCTCGGTTCTCACGGCTATTCTTCCGATTTGCCG
GCCCAGTTGATGGAACGGTACGGCGTCGAGGCCGACGTCGCTCACCACTTGTCCACCAATTACGGTGACCGTGCC
TGGGCTGTCCTGGCCGATACGCGCCCCGAGGCTACGTCCCGTCTTTCGGCGTCGTTTCCTTTTGTAGAGGCCGAG
ATTCGGTACGCCGTTCGGCATGAGGCGGCCTGTACCGCCGCCGATGTCATCGCTCGCCGACTGCGGCTTTCTTTC
CTCGACGTTGACGAGGCTCTACGCGCTCTTCCGCGTGTCATTGATATTATGGCCGACGAGTTGCGTTGGCTGCCG
TCCCGTCGTGATAAGGAGTGGTCTGCTACCGTCCGCTTCCTGCGAAGCATGGGCCTTGCGGAGGAGAGACTGGCC
GTGACGAGAGAAGAGGTTGTCAATGGGTTGACGGGCAAGCAGACGGCGAAGCAGGTGAAGAACGAGGTCTGTACA
TCGTCACCGTCGTCTGTGGGAGTGGGAGCGAGGACGAGGGATGATGACAAGGCGGCTGGCGAGTTGGCGCCCGAG
ACGTGA
Transcript >Ophcf2|06836
ATGCCCCCCCCCTTCTCTAGGGCTATCCGCCCATTGGCCGCCCTCGTCGCAGCTTCAGGCCTCGCAGCGACTCTC
GCCTTTCGCCGCCAGGATACCCCTAGACGCGACCCTGTCAGCCACCGCGACGCCTCGGGCCGCATCGTGCCACCA
TCGTTCCCTACCCTGTCCTCGCGAGCCCAGCAGCTGGCATCTCTTCGAAGCGGGCGCGAATACGACATCATCGTC
ATCGGAGGCGGAGCGACGGGTTCGGGCATCGCGCTCGACGCGGTAACGCGAGGTCTACGCGTCGCTCTCGTCGAA
GGGGATGACTTTTCGTCGGGAACCAGTTCCAAGAGCACGAAACTGGTGCACGGGGGCGTTCGATACCTGGAAAAG
GCGGTATGGAATCTTGACTGGGCGCAGCTGCAGCTCGTCATGGAGGCCTTGCGCGAGAGGAGGGCTTTTCTCGAT
ATTGCGCCTCATCTGTCTGGATCCTTGCCCATCCTGCTGCCTTTACAGAGGATATGGCAGGCTCCGTACCTGTGG
GCTGGATGCAAGATGTACGACCTGCTGGCGGGCTCGCACGGGCTGGAGAGGTCTTATATCATGGGGCCGACTCGG
GCCCTCGAGGCCTGTCCGCTCCTGAGGAGAGAGGGCTTGGTTGGGGCGCTGGTTTACTACGATGGCCAGCATAAT
GACTCGCGCATGAACGTCTCACTGGCTTTGACGGCTGCGCTGTACGGGGCTACCGTCGTCAATCACGTCGAGGTC
GTGGCCCTGGACAAGGATGATACGGGGAGGGTTCGAGGCGTGCGCGTGAGGGATCTCATGGCTGATGACAATGGT
GACGATGGCTTCATCGTTGCTGGGAAAGGCGTCGTCAACGCTACCGGTCCCTTTACCGATGCCGTCGAGCGGATG
GATGACGCCAGCCGAAAGCCCATCGTCGCCCCGGCATCAGGCGCCCACGTCATGCTACCCGGCTCTCTGTGTCCT
AACGGGATGGGCATCCTCGACGCCCACTCGTCCGACGGCCGCGTCGTCTTCGTCCTCCCCTGGCAGGGAAAGACG
GTGGCTGGCACGACGGACAATACCTGCCATGTTGAACGTGAGCCCGTCGCCCGTTCTGATGATGTCGACTTCATC
CTCGCTGCTGTTGGGAGGTTGTTGGGGCCCGAGTCGGCGCCTACGCGTGACGATGTGCTGGCTACATGGTCTGGT
ATCCGTCCCCTCGTCAAAGATCCCCATGCCGCTGGTAAGACAGAGGCTCTCGTCCGCTCCCACCTCGTCACCGTC
TCGCCATCTGGCCTCCTTACCTGCACAGGCGGCAAGTGGACAACCTACCGCCAGATGGCCCAAGACGCCGTCGAC
GAAGCCATCCGCGTCTTTGACCTCGAGCCGCGCTCCCTCACCCTCCCCGATATAAGCGGCCAGGGCCTCGAGCCC
ATGACCACGGACGGGACCTGTCGCACCCTTCGCACCCCCGTCCTCGGTTCTCACGGCTATTCTTCCGATTTGCCG
GCCCAGTTGATGGAACGGTACGGCGTCGAGGCCGACGTCGCTCACCACTTGTCCACCAATTACGGTGACCGTGCC
TGGGCTGTCCTGGCCGATACGCGCCCCGAGGCTACGTCCCGTCTTTCGGCGTCGTTTCCTTTTGTAGAGGCCGAG
ATTCGGTACGCCGTTCGGCATGAGGCGGCCTGTACCGCCGCCGATGTCATCGCTCGCCGACTGCGGCTTTCTTTC
CTCGACGTTGACGAGGCTCTACGCGCTCTTCCGCGTGTCATTGATATTATGGCCGACGAGTTGCGTTGGCTGCCG
TCCCGTCGTGATAAGGAGTGGTCTGCTACCGTCCGCTTCCTGCGAAGCATGGGCCTTGCGGAGGAGAGACTGGCC
GTGACGAGAGAAGAGGTTGTCAATGGGTTGACGGGCAAGCAGACGGCGAAGCAGGTGAAGAACGAGGTCTGTACA
TCGTCACCGTCGTCTGTGGGAGTGGGAGCGAGGACGAGGGATGATGACAAGGCGGCTGGCGAGTTGGCGCCCGAG
ACGTGA
Gene >Ophcf2|06836
ATGCCCCCCCCCTTCTCTAGGGCTATCCGCCCATTGGCCGCCCTCGTCGCAGCTTCAGGCCTCGCAGCGACTCTC
GCCTTTCGCCGCCAGGATACCCCTAGACGCGACCCTGTCAGCCACCGCGACGCCTCGGGCCGCATCGTGCCACCA
TCGTTCCCTACCCTGTCCTCGCGAGCCCAGCAGCTGGCATCTCTTCGAAGCGGGCGCGAATACGACATCATCGTC
ATCGGAGGCGGAGCGACGGGTTCGGGCATCGCGCTCGACGCGGTAACGCGAGGTCTACGCGTCGCTCTCGTCGAA
GGGGATGACTTTTCGTCGGGAACCAGTTCCAAGAGCACGAAACTGGTGCACGGGGGCGTTCGATACCTGGAAAAG
GCGGTATGGAATCTTGACTGGGCGCAGCTGCAGCTCGTCATGGAGGCCTTGCGCGAGAGGAGGGCTTTTCTCGAT
ATTGCGCCTCATCTGTCTGGATCCTTGCCCATCCTGCTGCCTTTACAGAGGATATGGCAGGCTCCGTACCTGTGG
GCTGGATGCAAGATGTACGACCTGCTGGCGGGCTCGCACGGGCTGGAGAGGTCTTATATCATGGGGCCGACTCGG
GCCCTCGAGGCCTGTCCGCTCCTGAGGAGAGAGGGCTTGGTTGGGGCGCTGGTTTACTACGATGGCCAGCATAAT
GACTCGCGCATGAACGTCTCACTGGCTTTGACGGCTGCGCTGTACGGGGCTACCGTCGTCAATCACGTCGAGGTC
GTGGCCCTGGACAAGGATGATACGGGGAGGGTTCGAGGCGTGCGCGTGAGGGATCTCATGGCTGATGACAATGGT
GACGATGGCTTCATCGTTGCTGGGAAAGGCGTCGTCAACGCTACCGGTCCCTTTACCGATGCCGTCGAGCGGATG
GATGACGCCAGCCGAAAGCCCATCGTCGCCCCGGCATCAGGCGCCCACGTCATGCTACCCGGCTCTCTGTGTCCT
AACGGGATGGGCATCCTCGACGCCCACTCGTCCGACGGCCGCGTCGTCTTCGTCCTCCCCTGGCAGGGAAAGACG
GTGGCTGGCACGACGGACAATACCTGCCATGTTGAACGTGAGCCCGTCGCCCGTTCTGATGATGTCGACTTCATC
CTCGCTGCTGTTGGGAGGTTGTTGGGGCCCGAGTCGGCGCCTACGCGTGACGATGTGCTGGCTACATGGTCTGGT
GTGTGCTCATCGTCTTCTGATGGTCCTGGGTCTTTGTACCGACTGACATTCATTCCTAGGTATCCGTCCCCTCGT
CAAAGATCCCCATGCCGCTGGTAAGACAGAGGCTCTCGTCCGCTCCCACCTCGTCACCGTCTCGCCATCTGGCCT
CCTTACCTGCACAGGCGGCAAGTGGACAACCTACCGCCAGATGGCCCAAGACGCCGTCGACGAAGCCATCCGCGT
CTTTGACCTCGAGCCGCGCTCCCTCACCCTCCCCGATATAAGCGGCCAGGGCCTCGAGCCCATGACCACGGACGG
GACCTGTCGCACCCTTCGCACCCCCGTCCTCGGTTCTCACGGCTATTCTTCCGATTTGCCGGCCCAGTTGATGGA
ACGGTACGGCGTCGAGGCCGACGTCGCTCACCACTTGTCCACCAATTACGGTGACCGTGCCTGGGCTGTCCTGGC
CGATACGCGCCCCGAGGCTACGTCCCGTCTTTCGGCGTCGTTTCCTTTTGTAGAGGCCGAGATTCGGTACGCCGT
TCGGCATGAGGCGGCCTGTACCGCCGCCGATGTCATCGCTCGCCGACTGCGGCTTTCTTTCCTCGACGTTGACGA
GGCTCTACGCGCTCTTCCGCGTGTCATTGATATTATGGCCGACGAGTTGCGTTGGCTGCCGTCCCGTCGTGATAA
GGAGTGGTCTGCTACCGTCCGCTTCCTGCGAAGCATGGGCCTTGCGGAGGAGAGACTGGCCGTGACGAGAGAAGA
GGTTGTCAATGGGTTGACGGGCAAGCAGACGGCGAAGCAGGTGAAGAACGAGGTCTGTACATCGTCACCGTCGTC
TGTGGGAGTGGGAGCGAGGACGAGGGATGATGACAAGGCGGCTGGCGAGTTGGCGCCCGAGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail