Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06831
Gene name
Locationscaffold_08:1166076..1167163
Strand+
Gene length (bp)1087
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 5.7E-07 53 68
PF00098 zf-CCHC Zinc knuckle 1.6E-08 74 90
PF00098 zf-CCHC Zinc knuckle 2.9E-08 97 112
PF00098 zf-CCHC Zinc knuckle 4.4E-08 126 141
PF00098 zf-CCHC Zinc knuckle 1.4E-05 156 171
PF00098 zf-CCHC Zinc knuckle 6.8E-09 176 192
PF00098 zf-CCHC Zinc knuckle 9.6E-06 201 217
PF14392 zf-CCHC_4 Zinc knuckle 1.3E-02 51 68
PF14392 zf-CCHC_4 Zinc knuckle 1.6E+00 75 89
PF14392 zf-CCHC_4 Zinc knuckle 1.1E+00 98 112
PF14392 zf-CCHC_4 Zinc knuckle 4.3E-01 126 141
PF14392 zf-CCHC_4 Zinc knuckle 3.2E+00 157 171
PF14392 zf-CCHC_4 Zinc knuckle 2.7E-01 177 192
PF14392 zf-CCHC_4 Zinc knuckle 4.1E-01 200 216
PF13917 zf-CCHC_3 Zinc knuckle 4.0E-01 94 112
PF13917 zf-CCHC_3 Zinc knuckle 1.8E-01 122 140

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2554 0.2849 0.1393 0.0489 0.8 0.3502 0.0831 0.0333 0.0827 0.0263

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5660
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|634
Ophiocordyceps camponoti-floridani Ophcf2|06831 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|709
Ophiocordyceps kimflemingae Ophio5|8087
Ophiocordyceps subramaniannii Hirsu2|8134

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06831
MLSRFTAAAGKLLARSSLISLSSQRPCPSIISRLSLVEKRLHTIEKMDYTRGACYSCGATGHQARECPTKGPAKC
YNCGGEGHLSRDCPEPMKENKSCYKCGQAGHISRDCPMGGGPPAGGQSTECYKCGEMGHIARNCPKSSFGGGAFS
GGSSGKTCYSCGGYGHMSRECVNGMKCYNCGESGHYSRDCPKESAAGGEKICYKCQQVGHVQAQCPN*
Coding >Ophcf2|06831
ATGCTTTCCCGGTTTACTGCAGCAGCTGGCAAACTACTCGCTCGGTCTTCTCTTATCTCTCTTTCCTCCCAGCGA
CCTTGCCCTTCGATAATCTCTCGTCTATCTCTTGTCGAGAAACGCCTACACACTATTGAGAAAATGGACTATACG
CGCGGCGCGTGCTACTCTTGCGGTGCCACTGGCCATCAGGCCCGTGAGTGCCCCACCAAGGGCCCTGCGAAATGC
TACAACTGTGGCGGCGAGGGTCACCTCAGTCGAGACTGTCCTGAGCCGATGAAAGAGAACAAGTCGTGCTACAAA
TGCGGCCAGGCCGGCCACATCTCGCGTGACTGCCCCATGGGCGGAGGCCCCCCGGCCGGTGGTCAATCCACCGAA
TGTTACAAGTGCGGTGAGATGGGACACATTGCTCGCAACTGTCCCAAGTCTTCGTTTGGAGGCGGTGCTTTCAGT
GGCGGCAGTTCCGGCAAGACGTGCTACTCTTGCGGTGGCTACGGCCACATGTCGCGGGAATGCGTCAACGGCATG
AAGTGCTACAATTGCGGCGAGTCGGGCCATTACTCTCGCGACTGCCCCAAGGAGTCGGCCGCGGGAGGCGAAAAG
ATTTGCTACAAGTGCCAGCAGGTCGGACACGTCCAGGCGCAGTGCCCCAACTAA
Transcript >Ophcf2|06831
ATGCTTTCCCGGTTTACTGCAGCAGCTGGCAAACTACTCGCTCGGTCTTCTCTTATCTCTCTTTCCTCCCAGCGA
CCTTGCCCTTCGATAATCTCTCGTCTATCTCTTGTCGAGAAACGCCTACACACTATTGAGAAAATGGACTATACG
CGCGGCGCGTGCTACTCTTGCGGTGCCACTGGCCATCAGGCCCGTGAGTGCCCCACCAAGGGCCCTGCGAAATGC
TACAACTGTGGCGGCGAGGGTCACCTCAGTCGAGACTGTCCTGAGCCGATGAAAGAGAACAAGTCGTGCTACAAA
TGCGGCCAGGCCGGCCACATCTCGCGTGACTGCCCCATGGGCGGAGGCCCCCCGGCCGGTGGTCAATCCACCGAA
TGTTACAAGTGCGGTGAGATGGGACACATTGCTCGCAACTGTCCCAAGTCTTCGTTTGGAGGCGGTGCTTTCAGT
GGCGGCAGTTCCGGCAAGACGTGCTACTCTTGCGGTGGCTACGGCCACATGTCGCGGGAATGCGTCAACGGCATG
AAGTGCTACAATTGCGGCGAGTCGGGCCATTACTCTCGCGACTGCCCCAAGGAGTCGGCCGCGGGAGGCGAAAAG
ATTTGCTACAAGTGCCAGCAGGTCGGACACGTCCAGGCGCAGTGCCCCAACTAA
Gene >Ophcf2|06831
ATGCTTTCCCGGTTTACTGCAGCAGCTGGCAAACTACTCGCTCGGTCTTCTCTTATCTCTCTTTCCTCCCAGCGA
CCTTGCCGTGCGGCCACCTTTGCTGGATGCTTTGCTGGGTGCTGGCTCTCGCTAACAAGATTGTTTCCAGCTTCG
ATAATCTCTCGTCTATCTCTTGTCGAGAAACGCCTACACACTATTGAGAAAATGGACTATACGCGCGGCGCGTGC
TACTCTTGTCAGTCCTTTGCCCCTCATCGCCCCGTCTCTACTGACTCGAATTCGTCACAGGCGGTGCCACTGGCC
ATCAGGTGCGCCAGCAAATTCTTCATCTCTCCAACTCCCTATCCGTCTGACCTTGAACAGGCCCGTGAGTGCCCC
ACCAAGGGCCCTGCGAAATGGTTTGTCGTGCGTCTCCTCTCGTGAGGGTTTGCTGACACGGCACATAGCTACAAC
TGTGGCGGTATGAGCATTCTCCCCTCTTCTTTTGGTCATTTCGCTAACCCACTGGCAGGCGAGGGTCACCTCAGT
CAGTCACCATTCCCGTCCTGTCGTTCGAGTCCTCGACTGACGAATTCCCAGGTCGAGACTGTCCTGAGCCGATGA
AAGAGAACAAGTCGTGCTACAAATGCGGCCAGGCCGGCCACATCTCGCGTGACTGCCCCATGGGCGGAGGCCCCC
CGGCCGGTGGTCAATCCACCGAATGTTACAAGGTGAGGGAGACGCTGCCTCGTTCTCCACGTCGGTCGACTGACG
AGGCCGGAACTCAGTGCGGTGAGATGGGACACATTGCTCGCAACTGTCCCAAGTCTTCGTTTGGAGGCGGTGCTT
TCAGTGGCGGCAGTTCCGGCAAGACGTGCTACTCTTGCGGTGGCTACGGCCACATGTCGCGTACGTCAAGGCAAC
CACCCGTCGGCCTCGCAGCGGCTGCTGACTCTGTGCAGGGGAATGCGTCAACGGCATGAAGTGCTACAATTGCGG
CGAGTCGGGCCATTACTCTCGCGACTGCCCCAAGGAGTCGGCCGCGGGAGGCGAAAAGATTTGCTACAAGTGCCA
GCAGGTCGGACACGTCCAGGCGCAGTGCCCCAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail