Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06823
Gene name
Locationscaffold_08:1143015..1143717
Strand+
Gene length (bp)702
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00578 AhpC-TSA AhpC/TSA family 9.7E-27 76 189
PF08534 Redoxin Redoxin 3.0E-14 78 190

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0016209 antioxidant activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3823 0.7101 0.065 0.0447 0.1517 0.0257 0.1495 0.024 0.0677 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3673
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4987
Ophiocordyceps australis map64 (Brazil) OphauB2|626
Ophiocordyceps camponoti-floridani Ophcf2|06823 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4271
Ophiocordyceps kimflemingae Ophio5|313
Ophiocordyceps subramaniannii Hirsu2|71

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06823
MPVELRKRKAPPPAPPAPKKKTGGKKTSPKEVPEEVPEEVPEEVPEEVADEEDAPQKKQKPVVGHVLQLDGFGGE
IQDDDGQNTSLKDLVEDCEKAVVLFTYPKASTPGCTTQACLFRDAYESLVEDGLSIYGLSNDKPQANSKFKEKQK
LQYPLLCDPDATLIAALGFKKEPKGTQRGVFVIDKEARVLVCQPGSPAATVECVKQLVQELKA*
Coding >Ophcf2|06823
ATGCCCGTCGAGCTTCGCAAGCGCAAGGCCCCCCCGCCCGCTCCACCGGCGCCCAAGAAGAAGACGGGAGGCAAG
AAGACGTCGCCCAAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCGCGGAC
GAGGAAGACGCGCCGCAGAAGAAACAGAAGCCAGTTGTCGGGCATGTTCTCCAACTTGACGGCTTCGGCGGCGAG
ATTCAAGATGACGACGGTCAGAATACGTCGCTCAAGGACCTAGTCGAGGACTGCGAAAAGGCAGTCGTCCTGTTT
ACCTACCCAAAGGCGTCAACGCCCGGCTGCACTACCCAGGCGTGTCTCTTCCGCGACGCCTACGAGTCCCTCGTC
GAGGACGGCCTCTCCATCTACGGCCTCAGCAACGACAAGCCACAGGCGAATTCGAAATTCAAGGAGAAGCAGAAG
CTGCAATACCCGCTTCTCTGCGATCCTGACGCGACCCTCATCGCCGCCCTCGGCTTCAAGAAGGAGCCCAAGGGC
ACCCAGCGCGGTGTGTTCGTCATCGACAAGGAGGCAAGGGTGTTGGTTTGCCAGCCGGGCTCGCCAGCCGCTACC
GTCGAATGCGTCAAGCAGCTGGTTCAGGAGCTGAAGGCGTGA
Transcript >Ophcf2|06823
ATGCCCGTCGAGCTTCGCAAGCGCAAGGCCCCCCCGCCCGCTCCACCGGCGCCCAAGAAGAAGACGGGAGGCAAG
AAGACGTCGCCCAAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCGCGGAC
GAGGAAGACGCGCCGCAGAAGAAACAGAAGCCAGTTGTCGGGCATGTTCTCCAACTTGACGGCTTCGGCGGCGAG
ATTCAAGATGACGACGGTCAGAATACGTCGCTCAAGGACCTAGTCGAGGACTGCGAAAAGGCAGTCGTCCTGTTT
ACCTACCCAAAGGCGTCAACGCCCGGCTGCACTACCCAGGCGTGTCTCTTCCGCGACGCCTACGAGTCCCTCGTC
GAGGACGGCCTCTCCATCTACGGCCTCAGCAACGACAAGCCACAGGCGAATTCGAAATTCAAGGAGAAGCAGAAG
CTGCAATACCCGCTTCTCTGCGATCCTGACGCGACCCTCATCGCCGCCCTCGGCTTCAAGAAGGAGCCCAAGGGC
ACCCAGCGCGGTGTGTTCGTCATCGACAAGGAGGCAAGGGTGTTGGTTTGCCAGCCGGGCTCGCCAGCCGCTACC
GTCGAATGCGTCAAGCAGCTGGTTCAGGAGCTGAAGGCGTGA
Gene >Ophcf2|06823
ATGCCCGTCGAGCTTCGCAAGCGCAAGGCCCCCCCGCCCGCTCCACCGGCGCCCAAGAAGAAGACGGGAGGCAAG
AAGACGTCGCCCAAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCCCGGAGGAGGTCGCGGAC
GAGGAAGACGCGCCGCAGAAGAAACAGAAGCCAGTTGTCGGGCATGTTCTCCAACTTGACGGCTTCGGCGGCGAG
ATTCAAGATGACGACGGTCAGAATACGTCGCTCAAGGACCTAGTCGAGGACTGCGAAAAGGCAGTCGTCCTGTTT
ACCTACCCAAAGGCGTCAACGCCCGGCTGTGAGTCTACATACACCCCGGTCCGCCATCCGTCCTCGTACTGACCT
TGTCTGACCCCAGGCACTACCCAGGCGTGTCTCTTCCGCGACGCCTACGAGTCCCTCGTCGAGGACGGCCTCTCC
ATCTACGGCCTCAGCAACGACAAGCCACAGGCGAATTCGAAATTCAAGGAGAAGCAGAAGCTGCAATACCCGCTT
CTCTGCGATCCTGACGCGACCCTCATCGCCGCCCTCGGCTTCAAGAAGGAGCCCAAGGGCACCCAGCGCGGTGTG
TTCGTCATCGACAAGGAGGCAAGGGTGTTGGTTTGCCAGCCGGGCTCGCCAGCCGCTACCGTCGAATGCGTCAAG
CAGCTGGTTCAGGAGCTGAAGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail