Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06820
Gene name
Locationscaffold_08:1139406..1139895
Strand+
Gene length (bp)489
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 5.3E-07 20 57

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Peroxisomal targeting signal 0.3898 0.7867 0.0526 0.1208 0.2292 0.0028 0.0144 0.0053 0.0161 0.2863

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3744
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4989
Ophiocordyceps australis map64 (Brazil) OphauB2|624
Ophiocordyceps camponoti-floridani Ophcf2|06820 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4268
Ophiocordyceps kimflemingae Ophio5|308
Ophiocordyceps subramaniannii Hirsu2|73

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06820
MTSDPLEDVLHLEDRYYHEGYQQGLDDGARAGHAEGRTFGMEKGLEKFLEGSRLAGRAVVWANRLPRREDVTAEN
LHRTDDDKPTGVEASQSNASSRFRRCVLPPLPDNTRIERNVRALYALVEPGTFSTENTDEAVQDFDSRMKRAQGK
AKIIERALGQGQ*
Coding >Ophcf2|06820
ATGACTTCTGACCCCCTCGAAGATGTCCTCCACCTTGAGGACCGCTACTACCACGAGGGCTACCAGCAAGGCCTA
GATGACGGCGCCCGAGCCGGACACGCCGAGGGCCGCACCTTTGGCATGGAGAAGGGCCTCGAAAAGTTTCTCGAG
GGAAGTCGTCTGGCTGGAAGGGCTGTCGTCTGGGCCAATAGATTACCTCGTCGGGAAGACGTCACTGCCGAAAAC
CTGCATCGGACCGACGATGACAAGCCAACAGGAGTGGAGGCCAGCCAGTCCAATGCCTCGTCTCGCTTCAGGCGC
TGCGTGCTACCGCCGCTACCAGACAATACGCGCATCGAGAGGAACGTCCGGGCGCTCTACGCGCTGGTCGAGCCG
GGGACGTTCTCGACGGAAAACACGGACGAGGCGGTGCAGGATTTCGACAGCCGCATGAAGCGGGCGCAGGGAAAG
GCAAAGATAATTGAGCGCGCCCTCGGCCAAGGCCAGTAG
Transcript >Ophcf2|06820
ATGACTTCTGACCCCCTCGAAGATGTCCTCCACCTTGAGGACCGCTACTACCACGAGGGCTACCAGCAAGGCCTA
GATGACGGCGCCCGAGCCGGACACGCCGAGGGCCGCACCTTTGGCATGGAGAAGGGCCTCGAAAAGTTTCTCGAG
GGAAGTCGTCTGGCTGGAAGGGCTGTCGTCTGGGCCAATAGATTACCTCGTCGGGAAGACGTCACTGCCGAAAAC
CTGCATCGGACCGACGATGACAAGCCAACAGGAGTGGAGGCCAGCCAGTCCAATGCCTCGTCTCGCTTCAGGCGC
TGCGTGCTACCGCCGCTACCAGACAATACGCGCATCGAGAGGAACGTCCGGGCGCTCTACGCGCTGGTCGAGCCG
GGGACGTTCTCGACGGAAAACACGGACGAGGCGGTGCAGGATTTCGACAGCCGCATGAAGCGGGCGCAGGGAAAG
GCAAAGATAATTGAGCGCGCCCTCGGCCAAGGCCAGTAG
Gene >Ophcf2|06820
ATGACTTCTGACCCCCTCGAAGATGTCCTCCACCTTGAGGACCGCTACTACCACGAGGGCTACCAGCAAGGCCTA
GATGACGGCGCCCGAGCCGGACACGCCGAGGGCCGCACCTTTGGCATGGAGAAGGGCCTCGAAAAGTTTCTCGAG
GGAAGTCGTCTGGCTGGAAGGGCTGTCGTCTGGGCCAATAGATTACCTCGTCGGGAAGACGTCACTGCCGAAAAC
CTGCATCGGACCGACGATGACAAGCCAACAGGAGTGGAGGCCAGCCAGTCCAATGCCTCGTCTCGCTTCAGGCGC
TGCGTGCTACCGCCGCTACCAGACAATACGCGCATCGAGAGGAACGTCCGGGCGCTCTACGCGCTGGTCGAGCCG
GGGACGTTCTCGACGGAAAACACGGACGAGGCGGTGCAGGATTTCGACAGCCGCATGAAGCGGGCGCAGGGAAAG
GCAAAGATAATTGAGCGCGCCCTCGGCCAAGGCCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail