Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06812
Gene name
Locationscaffold_08:1123299..1124234
Strand-
Gene length (bp)935
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.9E-05 94 118

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5547 0.5992 0.2953 0.0222 0.111 0.0093 0.03 0.0893 0.059 0.0386

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup834
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6171
Ophiocordyceps australis map64 (Brazil) OphauB2|614
Ophiocordyceps camponoti-floridani Ophcf2|06812 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1114
Ophiocordyceps kimflemingae Ophio5|5125
Ophiocordyceps subramaniannii Hirsu2|425
Ophiocordyceps subramaniannii Hirsu2|4433

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06812
MTPNRHFECGSCGKEFPHGCQARDNHCSSTGHSMPEYECDTCHRFYKTERACFQHMDDCNHWNRTFYKCGLCDQR
VRYLSKDSLVQHEYDEHDYCSDCDRIFQNYNNLRMHLNSRAHRGSSLACPFCGAGFVNGTGIAHHLEAGSCSEAR
GLNRDQMYRFVRSKDPNGVISKKLLEWTGSVQYEATANSYNGSGYECYLCHNEYSQLRHLTQHLNSPRHQSSLYH
CPNSSCRRDFKTLAGIINHFESESCGVTRFDKIQRQMDGFLRGQQRLEF*
Coding >Ophcf2|06812
ATGACGCCCAACCGGCATTTCGAGTGCGGTTCCTGCGGCAAGGAATTCCCCCACGGATGTCAAGCTCGCGATAAC
CACTGCTCATCGACGGGCCATTCAATGCCGGAATATGAGTGCGACACCTGCCATCGATTCTACAAGACGGAACGT
GCTTGCTTCCAGCACATGGACGACTGCAATCACTGGAACAGGACTTTTTACAAATGCGGGTTATGTGATCAGCGA
GTACGATACTTGTCGAAAGACAGCCTCGTTCAACACGAGTATGATGAGCACGACTATTGTTCCGACTGCGACCGC
ATATTCCAGAACTACAATAACTTGCGGATGCATCTCAACTCCCGCGCTCACAGGGGCTCTTCGCTGGCATGCCCC
TTCTGTGGCGCTGGGTTCGTAAATGGTACCGGTATCGCGCATCATCTTGAGGCCGGTTCCTGTTCCGAAGCACGG
GGCCTCAATCGGGATCAGATGTACCGATTCGTTCGGTCCAAGGATCCAAACGGCGTCATCTCCAAGAAGCTGCTC
GAATGGACGGGTTCGGTCCAGTATGAGGCCACCGCAAATTCCTACAATGGGTCTGGCTACGAATGCTATCTATGT
CACAACGAGTACTCCCAGCTTCGACATCTCACACAGCACCTGAACTCGCCCAGACACCAGTCGAGCCTCTATCAT
TGCCCCAATTCAAGCTGCCGCCGTGATTTCAAGACCCTCGCTGGCATCATCAACCACTTCGAGAGCGAGTCTTGC
GGCGTCACCAGGTTCGATAAGATTCAGCGGCAGATGGACGGTTTTCTACGCGGCCAGCAGCGCCTCGAGTTCTGA
Transcript >Ophcf2|06812
ATGACGCCCAACCGGCATTTCGAGTGCGGTTCCTGCGGCAAGGAATTCCCCCACGGATGTCAAGCTCGCGATAAC
CACTGCTCATCGACGGGCCATTCAATGCCGGAATATGAGTGCGACACCTGCCATCGATTCTACAAGACGGAACGT
GCTTGCTTCCAGCACATGGACGACTGCAATCACTGGAACAGGACTTTTTACAAATGCGGGTTATGTGATCAGCGA
GTACGATACTTGTCGAAAGACAGCCTCGTTCAACACGAGTATGATGAGCACGACTATTGTTCCGACTGCGACCGC
ATATTCCAGAACTACAATAACTTGCGGATGCATCTCAACTCCCGCGCTCACAGGGGCTCTTCGCTGGCATGCCCC
TTCTGTGGCGCTGGGTTCGTAAATGGTACCGGTATCGCGCATCATCTTGAGGCCGGTTCCTGTTCCGAAGCACGG
GGCCTCAATCGGGATCAGATGTACCGATTCGTTCGGTCCAAGGATCCAAACGGCGTCATCTCCAAGAAGCTGCTC
GAATGGACGGGTTCGGTCCAGTATGAGGCCACCGCAAATTCCTACAATGGGTCTGGCTACGAATGCTATCTATGT
CACAACGAGTACTCCCAGCTTCGACATCTCACACAGCACCTGAACTCGCCCAGACACCAGTCGAGCCTCTATCAT
TGCCCCAATTCAAGCTGCCGCCGTGATTTCAAGACCCTCGCTGGCATCATCAACCACTTCGAGAGCGAGTCTTGC
GGCGTCACCAGGTTCGATAAGATTCAGCGGCAGATGGACGGTTTTCTACGCGGCCAGCAGCGCCTCGAGTTCTGA
Gene >Ophcf2|06812
ATGACGCCCAACCGGCATTTCGAGTGCGGTTCCTGCGGCAAGGAATTCCCCCACGGATGTCAAGCTCGCGATAAC
CACTGCTCATCGACGGGCCATTCAATGCCGGAATATGAGTGCGACACCTGCCATCGATTCTACAAGACGGAACGT
GCTTGCTTCCAGCACATGGACGACTGCAATCACTGGAACAGGACTTTTTACAAATGCGGGTTATGTGATCAGCGA
GTACGATACTTGTCGAAAGACAGCCTCGTTCAACACGAGTATGATGAGCACGACTATTGTTCCGACTGCGACCGC
ATATTCCAGAACTACAATAACTTGCGGATGGTGAGTCTCATCATGAAGCTTACGGATTCGTGCCAACAAAACGAC
AACAGCATCTCAACTCCCGCGCTCACAGGGGCTCTTCGCTGGCATGCCCCTTCTGTGGCGCTGGGTTCGTAAATG
GTACCGGTATCGCGCATCATCTTGAGGCCGGTTCCTGTTCCGAAGCACGGGGCCTCAATCGGGATCAGATGTACC
GATTCGTTCGGTCCAAGGATCCAAACGGCGTCATCTCCAAGAAGCTGCTCGAATGGACGGGTTCGGTCCAGTATG
AGGCCACCGCAAATTCCTACAATGGGTCTGGCTACGAATGCTATCTATGTCACAACGAGTACTCCCAGCTTCGAC
ATCTCACACAGCACCTGAACTCGCCCAGACGCAAGTCCTTTCCTCGCCGGCAAACTCTCTAGTCTTTTCACTAAC
ATTCTCGTATCATAGACCAGTCGAGCCTCTATCATTGCCCCAATTCAAGCTGCCGCCGTGATTTCAAGACCCTCG
CTGGCATCATCAACCACTTCGAGAGCGAGTCTTGCGGCGTCACCAGGTTCGATAAGATTCAGCGGCAGATGGACG
GTTTTCTACGCGGCCAGCAGCGCCTCGAGTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail