Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06811
Gene name
Locationscaffold_08:1120006..1121774
Strand-
Gene length (bp)1768
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family 2.9E-103 110 539

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.187 0.1386 0.2092 0.199 0.1474 0.0168 0.5735 0.4605 0.8495 0.1694

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2014
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1343
Ophiocordyceps australis map64 (Brazil) OphauB2|6018
Ophiocordyceps camponoti-floridani Ophcf2|06811 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1116
Ophiocordyceps kimflemingae Ophio5|5124
Ophiocordyceps subramaniannii Hirsu2|2268

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06811
MRRTSVSLPTKQVAHDPFEKPDRYQSDPRTHGPLLAMKEAWSPPSQRLRWLKTGAIALTIVLLLWWLSPRGVSVY
NEMSRSRGRDGQVPSDATYGTDRCSASYSKDKPVVQYALMVDAGSTGSRIHVYKFNNCGPVPELEKEEFMMTEKS
VGGLSKYKDDAVGAAKTLDPLMDVAMRHVPDALKACTPIAVKATAGLRLIGPEKSQAILDEVRRHLETDYPFPVV
SAAHDGVAVMDGALEGVYAWVTANYLLGKIGGPDKGDTAAVFDLGGGSTQIVFEPTFKGASDGGMPGKLADGDHK
YSLDFGGQKFDLYQHSHLGYGLMSARKAIHKTLISDLAAKKTGTAWMDQPIVHPCIAPGMSQDIEVDTEDGKPPR
SYNFTGPSAPAPAQCRNLAEKMLHKDAECKLAPCSFNGVHQPSLAKTFANQDVYIFSYFYDRTKPLGMPDSFTVR
ELHDLTQSVCAGKDGWDLFSSMPEAMEELSGRPEYCLDLSFMTALLHTGYDMPIDREVKIAKKIKGNELGWCLGA
SLPLLSSGSGWECKVKRLS*
Coding >Ophcf2|06811
ATGCGGAGGACCTCGGTGTCGCTGCCGACGAAGCAAGTTGCTCACGACCCCTTTGAGAAACCGGATCGCTATCAG
TCGGATCCCCGGACTCACGGTCCGCTCTTGGCCATGAAGGAGGCCTGGTCTCCCCCGTCGCAGCGGCTGCGATGG
CTCAAGACGGGCGCCATCGCCTTGACCATCGTCCTGCTGCTGTGGTGGCTGTCACCTCGCGGAGTCAGCGTCTAC
AATGAGATGTCCCGCTCTAGGGGTCGTGACGGTCAGGTCCCCTCTGACGCGACGTATGGCACCGACCGCTGCAGC
GCCTCGTACTCCAAGGATAAGCCCGTCGTTCAGTACGCTCTCATGGTGGACGCTGGCAGCACGGGCTCGCGTATC
CACGTGTACAAGTTTAACAACTGCGGTCCCGTGCCGGAACTCGAAAAGGAAGAGTTTATGATGACGGAAAAGTCG
GTCGGCGGCCTGAGCAAATACAAGGACGATGCTGTCGGCGCCGCCAAGACTCTCGACCCCCTGATGGACGTGGCC
ATGCGCCATGTGCCCGATGCGCTCAAGGCCTGCACTCCCATCGCCGTCAAGGCCACGGCCGGCCTACGCCTGATC
GGTCCGGAAAAATCGCAGGCCATCCTCGACGAGGTCCGCCGTCACCTCGAGACCGATTATCCTTTCCCCGTCGTC
TCGGCCGCCCACGATGGCGTCGCCGTAATGGACGGTGCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTAC
CTCCTCGGAAAGATTGGCGGGCCCGACAAGGGCGATACCGCTGCCGTTTTCGATCTCGGCGGCGGCTCTACCCAA
ATCGTCTTCGAACCGACCTTTAAGGGCGCCTCGGACGGTGGAATGCCGGGAAAGCTCGCCGACGGAGATCACAAG
TACTCGCTCGACTTTGGCGGCCAAAAGTTTGACCTCTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCGGCT
CGCAAGGCCATTCACAAGACGCTCATCTCGGACCTGGCCGCCAAGAAGACGGGCACCGCCTGGATGGACCAGCCC
ATCGTCCACCCCTGCATCGCCCCGGGCATGTCGCAGGATATCGAGGTCGATACGGAAGACGGCAAGCCCCCGAGG
TCCTACAACTTCACCGGTCCCTCGGCCCCGGCTCCGGCCCAGTGCCGCAACCTGGCGGAGAAGATGCTGCACAAG
GACGCCGAATGCAAGCTGGCCCCCTGCTCCTTCAACGGCGTCCACCAGCCCTCGCTGGCAAAGACGTTCGCCAAC
CAAGACGTCTACATCTTCTCCTACTTCTATGACCGCACCAAGCCGCTGGGCATGCCCGACTCCTTCACCGTCCGG
GAGCTGCACGACTTGACGCAGTCCGTCTGCGCCGGCAAGGACGGCTGGGACCTCTTCTCGAGCATGCCCGAGGCC
ATGGAAGAGCTGAGCGGCCGTCCCGAGTACTGCCTGGACCTGAGCTTCATGACGGCTCTGCTCCACACGGGCTAC
GACATGCCCATCGACCGTGAGGTCAAGATTGCCAAGAAGATCAAGGGCAACGAGCTGGGATGGTGCCTCGGTGCC
AGCCTGCCCCTGCTCTCTTCCGGCTCCGGTTGGGAGTGCAAAGTCAAGAGGCTATCTTAG
Transcript >Ophcf2|06811
ATGCGGAGGACCTCGGTGTCGCTGCCGACGAAGCAAGTTGCTCACGACCCCTTTGAGAAACCGGATCGCTATCAG
TCGGATCCCCGGACTCACGGTCCGCTCTTGGCCATGAAGGAGGCCTGGTCTCCCCCGTCGCAGCGGCTGCGATGG
CTCAAGACGGGCGCCATCGCCTTGACCATCGTCCTGCTGCTGTGGTGGCTGTCACCTCGCGGAGTCAGCGTCTAC
AATGAGATGTCCCGCTCTAGGGGTCGTGACGGTCAGGTCCCCTCTGACGCGACGTATGGCACCGACCGCTGCAGC
GCCTCGTACTCCAAGGATAAGCCCGTCGTTCAGTACGCTCTCATGGTGGACGCTGGCAGCACGGGCTCGCGTATC
CACGTGTACAAGTTTAACAACTGCGGTCCCGTGCCGGAACTCGAAAAGGAAGAGTTTATGATGACGGAAAAGTCG
GTCGGCGGCCTGAGCAAATACAAGGACGATGCTGTCGGCGCCGCCAAGACTCTCGACCCCCTGATGGACGTGGCC
ATGCGCCATGTGCCCGATGCGCTCAAGGCCTGCACTCCCATCGCCGTCAAGGCCACGGCCGGCCTACGCCTGATC
GGTCCGGAAAAATCGCAGGCCATCCTCGACGAGGTCCGCCGTCACCTCGAGACCGATTATCCTTTCCCCGTCGTC
TCGGCCGCCCACGATGGCGTCGCCGTAATGGACGGTGCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTAC
CTCCTCGGAAAGATTGGCGGGCCCGACAAGGGCGATACCGCTGCCGTTTTCGATCTCGGCGGCGGCTCTACCCAA
ATCGTCTTCGAACCGACCTTTAAGGGCGCCTCGGACGGTGGAATGCCGGGAAAGCTCGCCGACGGAGATCACAAG
TACTCGCTCGACTTTGGCGGCCAAAAGTTTGACCTCTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCGGCT
CGCAAGGCCATTCACAAGACGCTCATCTCGGACCTGGCCGCCAAGAAGACGGGCACCGCCTGGATGGACCAGCCC
ATCGTCCACCCCTGCATCGCCCCGGGCATGTCGCAGGATATCGAGGTCGATACGGAAGACGGCAAGCCCCCGAGG
TCCTACAACTTCACCGGTCCCTCGGCCCCGGCTCCGGCCCAGTGCCGCAACCTGGCGGAGAAGATGCTGCACAAG
GACGCCGAATGCAAGCTGGCCCCCTGCTCCTTCAACGGCGTCCACCAGCCCTCGCTGGCAAAGACGTTCGCCAAC
CAAGACGTCTACATCTTCTCCTACTTCTATGACCGCACCAAGCCGCTGGGCATGCCCGACTCCTTCACCGTCCGG
GAGCTGCACGACTTGACGCAGTCCGTCTGCGCCGGCAAGGACGGCTGGGACCTCTTCTCGAGCATGCCCGAGGCC
ATGGAAGAGCTGAGCGGCCGTCCCGAGTACTGCCTGGACCTGAGCTTCATGACGGCTCTGCTCCACACGGGCTAC
GACATGCCCATCGACCGTGAGGTCAAGATTGCCAAGAAGATCAAGGGCAACGAGCTGGGATGGTGCCTCGGTGCC
AGCCTGCCCCTGCTCTCTTCCGGCTCCGGTTGGGAGTGCAAAGTCAAGAGGCTATCTTAG
Gene >Ophcf2|06811
ATGCGGAGGACCTCGGTGTCGCTGCCGACGAAGCAAGTTGCTCACGACCCCTTTGAGAAACCGGATCGCTATCAG
TCGGATCCCCGGACTCACGGTCCGCTCTTGGCCATGAAGGAGGCCTGGTCTCCCCCGTCGCAGCGGCTGCGATGG
CTCAAGACGGGCGCCATCGCCTTGACCATCGTCCTGCTGCTGTGGTGGCTGTCACCTCGCGGAGTCAGCGTCTAC
AATGAGAGTGGGTGACTGACTAAATGTCTCTTCGTTCTCCGTACCGTTGGCATCGCTGACGTCGGACTCGCTGCG
ACAGTGTCCCGCTCTAGGGGTCGTGACGGTCAGGTCCCCTCTGACGCGACGTATGGCACCGACCGCTGCAGCGCC
TCGTACTCCAAGGATAAGCCCGTCGTTCAGTACGCTCTCATGGTGGACGCTGGCAGCACGGGCTCGCGTATCCAC
GTGTACAAGTTTAACAACTGCGGTCCCGTGCCGGAACTCGAAAAGGAAGAGTTTATGATGACGGAAAAGTCGGTC
GGCGGCCTGAGCAAATACAAGGACGATGCTGTCGGCGCCGCCAAGACTCTCGACCCCCTGATGGACGTGGCCATG
CGCCATGTGCCCGATGCGCTCAAGGCCTGCACTCCCATCGCCGTCAAGGCCACGGCCGGCCTACGCCTGATCGGT
CCGGAAAAATCGCAGGCCATCCTCGACGAGGTCCGCCGTCACCTCGAGACCGATTATCCTTTCCCCGTCGTCTCG
GCCGCCCACGATGGCGTCGCCGTAATGGACGGTGCCCTCGAGGGCGTCTACGCCTGGGTCACGGCCAACTACCTC
CTCGGAAAGATTGGCGGGCCCGACAAGGGCGATACCGCTGCCGTTTTCGATCTCGGCGGCGGCTCTACCCAAATC
GTCTTCGAACCGACCTTTAAGGGCGCCTCGGACGGTGGAATGCCGGGAAAGCTCGCCGACGGAGATCACAAGTAC
TCGCTCGACTTTGGCGGCCAAAAGTTTGACCTCTACCAGCACTCGCATCTCGGCTACGGCCTCATGTCGGCTCGC
AAGGCCATTCACAAGACGCTCATCTCGGACCTGGCCGCCAAGAAGACGGGCACCGCCTGGATGGACCAGCCCATC
GTCCACCCCTGCATCGCCCCGGGCATGTCGCAGGATATCGAGGTCGATACGGAAGACGGCAAGCCCCCGAGGTCC
TACAACTTCACCGGTCCCTCGGCCCCGGCTCCGGCCCAGTGCCGCAACCTGGCGGAGAAGATGCTGCACAAGGAC
GCCGAATGCAAGCTGGCCCCCTGCTCCTTCAACGGCGTCCACCAGCCCTCGCTGGCAAAGACGTTCGCCAACCAA
GACGTCTACATCTTCTCCTACTTCTATGACCGCACCAAGCCGCTGGGCATGCCCGACTCCTTCACCGTCCGGGAG
CTGCACGACTTGACGCAGTCCGTCTGCGCCGGCAAGGACGGCTGGGACCTCTTCTCGAGCATGCCCGAGGCCATG
GAAGAGCTGAGCGGCCGTCCCGAGTACTGCCTGGACCTGAGCTTCATGACGGCTCTGCTCCACACGGGCTACGAC
ATGCCCATCGACCGTGAGGTCAAGATTGCCAAGAAGATCAAGGGCAACGAGCTGGGATGGTGCCTCGGTGCCAGG
TGAGTCGGGCTCCTTTGTCCTCTTGAATCCTTCAAACTGACCCTCCGCGCCTGTCTCCAGCCTGCCCCTGCTCTC
TTCCGGCTCCGGTTGGGAGTGCAAAGTCAAGAGGCTATCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail