Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06802
Gene name
Locationscaffold_08:1103994..1105250
Strand-
Gene length (bp)1256
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16131 Torus Torus domain 2.8E-41 48 153
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.2E-08 189 240

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3049 0.8412 0.0271 0.0336 0.0463 0.0058 0.0362 0.0081 0.0305 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2457
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1337
Ophiocordyceps australis map64 (Brazil) OphauB2|6012
Ophiocordyceps camponoti-floridani Ophcf2|06802 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1124
Ophiocordyceps kimflemingae Ophio5|4128
Ophiocordyceps subramaniannii Hirsu2|3532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06802
MADAETAQMPEIEADGPSSLERDAMALAKTETAVAAPAEKKKKVIRRRKRPARAQIDPDSISSEPPPQTGTVFNI
WYNKWSGGDRESYQQTHARGRCNIAQDSGYTKADNVVGSYFCLRFARGLCPMGQDCDYLHRLPSTLDLFSPNVDC
FGRDKFAGYRDDMGGVGSFMRQNRTVYVGRIHVTEDIEEIVARHFAEWGQIERIRVLNQRGVGFITYTNEANAEF
AKEAMAHQSLDHEEILNVRWATADPNPMAQKREARRIEEQAAEAIRKALPAQFVAEIEGKDPEATKRRKLESSYG
LEGYEAPDEVHYARGPDAVNPVGREGFEVPTQPLALPSSEPPTVDQTFSRGGGIFSDRTLAALSGARIKVASKPK
SAATGPLVAYGSDDDDDDDDDDA*
Coding >Ophcf2|06802
ATGGCGGACGCCGAGACAGCACAAATGCCTGAAATCGAAGCGGATGGCCCTTCAAGCCTCGAAAGAGATGCCATG
GCTCTGGCAAAGACAGAGACGGCCGTCGCCGCTCCGGCTGAGAAGAAGAAAAAGGTGATACGACGGAGGAAGAGA
CCGGCTCGAGCGCAGATCGACCCCGACAGCATCAGCTCCGAGCCTCCACCCCAGACGGGCACCGTCTTCAACATC
TGGTACAACAAGTGGTCTGGCGGCGATCGCGAATCCTACCAGCAGACTCACGCGCGCGGGCGCTGCAACATTGCC
CAAGACAGCGGCTACACCAAGGCCGACAACGTTGTGGGGAGCTACTTTTGTCTGCGGTTCGCGAGGGGACTTTGC
CCCATGGGTCAGGACTGCGACTATCTCCATCGGCTGCCTTCCACGCTGGATCTGTTCAGTCCCAACGTGGACTGC
TTCGGGCGGGATAAGTTTGCCGGCTATCGTGACGACATGGGCGGCGTCGGAAGCTTCATGAGGCAGAACAGGACC
GTCTACGTCGGGCGAATCCATGTGACGGAAGATATCGAGGAGATTGTTGCGCGGCACTTTGCCGAATGGGGGCAG
ATCGAGCGCATTCGTGTCCTCAACCAGAGAGGCGTCGGCTTCATCACCTACACCAACGAGGCCAATGCCGAGTTC
GCCAAGGAGGCCATGGCACATCAGTCACTCGATCACGAAGAGATCCTCAACGTGCGCTGGGCCACGGCCGACCCG
AACCCGATGGCGCAGAAGCGAGAGGCGAGGAGGATCGAAGAGCAGGCGGCTGAAGCCATCCGCAAGGCGTTGCCG
GCCCAGTTCGTGGCTGAGATCGAAGGCAAGGATCCGGAGGCGACGAAGAGACGGAAACTGGAGAGCAGCTACGGT
CTCGAGGGCTACGAGGCACCCGACGAAGTGCACTATGCGCGGGGACCGGACGCCGTGAACCCCGTCGGGCGAGAA
GGGTTCGAAGTTCCGACGCAGCCATTGGCGCTGCCGAGCTCGGAGCCACCGACGGTCGATCAGACCTTCTCACGA
GGAGGAGGCATCTTCTCGGACCGCACGCTGGCAGCTCTGAGCGGGGCCAGGATCAAAGTCGCATCGAAACCCAAG
TCGGCGGCGACGGGACCGTTGGTGGCGTATGGCAGCGACGACGACGACGACGACGACGACGATGACGCGTGA
Transcript >Ophcf2|06802
ATGGCGGACGCCGAGACAGCACAAATGCCTGAAATCGAAGCGGATGGCCCTTCAAGCCTCGAAAGAGATGCCATG
GCTCTGGCAAAGACAGAGACGGCCGTCGCCGCTCCGGCTGAGAAGAAGAAAAAGGTGATACGACGGAGGAAGAGA
CCGGCTCGAGCGCAGATCGACCCCGACAGCATCAGCTCCGAGCCTCCACCCCAGACGGGCACCGTCTTCAACATC
TGGTACAACAAGTGGTCTGGCGGCGATCGCGAATCCTACCAGCAGACTCACGCGCGCGGGCGCTGCAACATTGCC
CAAGACAGCGGCTACACCAAGGCCGACAACGTTGTGGGGAGCTACTTTTGTCTGCGGTTCGCGAGGGGACTTTGC
CCCATGGGTCAGGACTGCGACTATCTCCATCGGCTGCCTTCCACGCTGGATCTGTTCAGTCCCAACGTGGACTGC
TTCGGGCGGGATAAGTTTGCCGGCTATCGTGACGACATGGGCGGCGTCGGAAGCTTCATGAGGCAGAACAGGACC
GTCTACGTCGGGCGAATCCATGTGACGGAAGATATCGAGGAGATTGTTGCGCGGCACTTTGCCGAATGGGGGCAG
ATCGAGCGCATTCGTGTCCTCAACCAGAGAGGCGTCGGCTTCATCACCTACACCAACGAGGCCAATGCCGAGTTC
GCCAAGGAGGCCATGGCACATCAGTCACTCGATCACGAAGAGATCCTCAACGTGCGCTGGGCCACGGCCGACCCG
AACCCGATGGCGCAGAAGCGAGAGGCGAGGAGGATCGAAGAGCAGGCGGCTGAAGCCATCCGCAAGGCGTTGCCG
GCCCAGTTCGTGGCTGAGATCGAAGGCAAGGATCCGGAGGCGACGAAGAGACGGAAACTGGAGAGCAGCTACGGT
CTCGAGGGCTACGAGGCACCCGACGAAGTGCACTATGCGCGGGGACCGGACGCCGTGAACCCCGTCGGGCGAGAA
GGGTTCGAAGTTCCGACGCAGCCATTGGCGCTGCCGAGCTCGGAGCCACCGACGGTCGATCAGACCTTCTCACGA
GGAGGAGGCATCTTCTCGGACCGCACGCTGGCAGCTCTGAGCGGGGCCAGGATCAAAGTCGCATCGAAACCCAAG
TCGGCGGCGACGGGACCGTTGGTGGCGTATGGCAGCGACGACGACGACGACGACGACGACGATGACGCGTGA
Gene >Ophcf2|06802
ATGGCGGACGCCGAGACAGCACAAATGCCTGAAATCGAAGCGGATGGCCCTTCAAGCCTCGAAAGAGATGCCATG
GCTCTGGCAAAGACAGAGACGGCCGTCGCCGCTCCGGCTGAGAAGAAGAAAAAGGTGATACGACGGAGGAAGAGA
CCGGCTCGAGCGCAGATCGACCCCGACAGCATCAGCTCCGAGCCTCCACCCCAGACGGGCACCGTCTTCAACATC
TGGTACAACAAGTGGTCTGGCGGCGATCGCGAATCCTACCAGCAGACTCACGCGCGCGGGCGCTGCAACATTGCC
CAAGACAGCGGCTACACCAAGGCCGACAACGTTGTGGGGAGCTACTTTTGTCTGCGGTTCGCGAGGGGACTTTGC
CCCATGGGTCAGGACTGCGACTATCTCCATCGGCTGCCTTCCACGCTGGATCTGTTCAGTCCCAACGTGGACTGC
TTCGGGCGGGATAAGTTTGCCGGCTATCGTGACGACATGGGCGGCGTCGGAAGCTTCATGAGGCAGAACAGGACC
GTCTACGTCGGGCGAATCCATGTGACGGAAGATATCGAGGAGATTGTTGCGCGGCACTTTGCCGAATGGGGGCAG
ATCGAGCGCAGTGAGTGCCCAAGTCTGTCACGCGAATCAAGTCGACAATGTTTACTCACCCACTTCAAGTTCGTG
TCCTCAACCAGAGAGGCGTCGGCTTCATCACCTACACCAACGAGGCCAATGCCGAGTTCGCCAAGGAGGCCATGG
CACATCAGTCACTCGATCACGAAGAGATCCTCAACGTGCGCTGGGCCACGGCCGACCCGAACCCGATGGCGCAGA
AGCGAGAGGCGAGGAGGATCGAAGAGCAGGCGGCTGAAGCCATCCGCAAGGCGTTGCCGGCCCAGTTCGTGGCTG
AGATCGAAGGCAAGGATCCGGAGGCGACGAAGAGACGGAAACTGGAGAGCAGCTACGGTCTCGAGGGCTACGAGG
CACCCGACGAAGTGCACTATGCGCGGGGACCGGACGCCGTGAACCCCGTCGGGCGAGAAGGGTTCGAAGTTCCGA
CGCAGCCATTGGCGCTGCCGAGCTCGGAGCCACCGACGGTCGATCAGACCTTCTCACGAGGAGGAGGCATCTTCT
CGGACCGCACGCTGGCAGCTCTGAGCGGGGCCAGGATCAAAGTCGCATCGAAACCCAAGTCGGCGGCGACGGGAC
CGTTGGTGGCGTATGGCAGCGACGACGACGACGACGACGACGACGATGACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail