Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06800
Gene name
Locationscaffold_08:1100666..1102504
Strand+
Gene length (bp)1838
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11500 Cut12 Cut12 conserved domain 3.3E-42 140 268

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal|Nuclear export signal 0.5766 0.4225 0.1116 0.1257 0.1818 0.049 0.1038 0.1694 0.43 0.0058

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2458
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1335
Ophiocordyceps australis map64 (Brazil) OphauB2|6010
Ophiocordyceps camponoti-floridani Ophcf2|06800 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1126
Ophiocordyceps kimflemingae Ophio5|4130
Ophiocordyceps subramaniannii Hirsu2|3534

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06800
MLGWMLRGGENAPNDEAQGDATQVEQPDTPAPVFAARALKSALFGTPARPDDSPRRQDTKASRRTMAKEDKPSSS
TPSKPPGILLTPGTGTSRRKRVSFGAEAASTDNGAETRSKATTKARAVDQVVTDDYESDGERMEALAKARTEASA
TGPKVIDDCSSDADWEEENDDDDGGLCTHDVTLDLNEPHSQSGRYWKGQFERYHQEAKAEMEKLLKYKQLAKSYA
RQKDAEALRLAGRLRDERQRVIKMEKKIANNASQIVSKHDDDDGEPTELLAKLTKQTALAAEYRQRVHELETELD
GLARQKDQGGEVGGRRRRVMTAASPTTQKTLVETQRELRRARTQLKELDGLRHEVSLLKARVKTAESQASTSSNK
GDATEAKARRLRSHLEESREETKRKTDELRQLKKEFEAFRRESEAHEADTRAVLERAHDKISELKREMRWLRTEA
NGDRRRATDGCVSGDDDDDVDDNNNNNNNDDAHQPRQDGRKKRDKDDALTERTNGLAPRWQPFVARSRGSTDSNP
ETVPVPPRKNDDDGVKKSRARSALPPERRAAALARIESRMEDKRRRAHDKENRRPATHLSLEL*
Coding >Ophcf2|06800
ATGCTTGGATGGATGCTGCGGGGTGGCGAAAATGCGCCGAACGATGAAGCTCAGGGAGACGCGACTCAGGTCGAG
CAGCCCGATACGCCTGCGCCCGTATTTGCGGCTCGAGCGTTGAAGAGTGCTCTCTTTGGTACACCCGCGCGGCCC
GACGACTCACCTCGACGGCAGGACACAAAGGCAAGCCGGCGGACCATGGCAAAGGAAGACAAGCCTTCATCGAGC
ACGCCTTCCAAGCCGCCCGGAATCCTCCTCACGCCCGGGACGGGCACCTCGCGACGGAAACGCGTCTCGTTTGGT
GCCGAAGCCGCCTCGACGGACAATGGCGCTGAGACGAGGTCAAAGGCCACGACCAAAGCTCGAGCTGTTGACCAG
GTTGTCACCGACGACTACGAGTCCGATGGAGAACGCATGGAGGCGCTGGCAAAGGCCAGGACCGAAGCTAGCGCC
ACTGGACCGAAAGTCATCGACGATTGCAGTTCCGACGCTGACTGGGAAGAGGAAAACGACGATGATGACGGCGGC
CTTTGCACGCACGACGTGACGCTGGATCTCAACGAGCCTCACTCGCAGTCTGGGCGGTACTGGAAGGGACAGTTC
GAGAGATATCATCAAGAAGCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTATGCC
CGGCAAAAGGACGCCGAGGCCCTCCGGCTGGCCGGGCGGCTCCGTGACGAGCGGCAGCGGGTCATCAAGATGGAA
AAGAAGATTGCAAACAACGCATCACAAATCGTCTCGAAGCACGACGACGACGATGGGGAGCCGACGGAACTACTG
GCAAAGCTCACCAAGCAGACTGCCCTCGCAGCCGAGTATCGACAGCGCGTGCACGAGCTCGAGACGGAGCTGGAC
GGGCTCGCGCGGCAGAAGGATCAAGGGGGCGAAGTCGGCGGTCGACGAAGGCGAGTGATGACGGCCGCCTCGCCG
ACGACACAGAAGACCTTGGTCGAGACACAGCGGGAACTCCGACGAGCGCGGACGCAACTGAAGGAATTGGACGGA
CTCCGCCACGAGGTATCCCTCCTCAAGGCTCGCGTCAAGACGGCCGAATCGCAGGCCAGCACGAGCAGCAACAAG
GGCGACGCCACCGAGGCCAAAGCCCGCAGACTGAGAAGCCATCTGGAGGAGTCGAGAGAGGAGACGAAACGAAAG
ACGGACGAGTTACGGCAGCTCAAGAAGGAGTTTGAGGCCTTTCGACGGGAGAGCGAAGCTCACGAGGCCGATACT
CGTGCCGTTCTCGAGCGGGCGCACGATAAGATTTCGGAGCTCAAGAGGGAGATGCGATGGCTTAGGACCGAAGCG
AACGGGGATCGCCGACGAGCCACTGATGGATGTGTATCGGGTGACGACGACGACGACGTCGACGACAACAACAAC
AACAACAACAACGACGACGCCCATCAGCCACGCCAAGACGGACGCAAGAAACGCGACAAGGACGACGCGTTGACG
GAACGGACCAACGGCCTGGCACCAAGATGGCAGCCATTTGTGGCCAGAAGCAGAGGCTCAACCGACTCAAACCCC
GAAACGGTACCCGTCCCACCGCGAAAGAACGATGACGATGGCGTCAAAAAATCCCGAGCTCGCAGCGCCCTCCCC
CCGGAACGTCGGGCAGCGGCGCTAGCCCGGATCGAGAGCCGGATGGAGGACAAGCGGCGGAGGGCACATGACAAG
GAGAACAGGCGGCCTGCGACGCACCTGAGCCTAGAATTATAG
Transcript >Ophcf2|06800
ATGCTTGGATGGATGCTGCGGGGTGGCGAAAATGCGCCGAACGATGAAGCTCAGGGAGACGCGACTCAGGTCGAG
CAGCCCGATACGCCTGCGCCCGTATTTGCGGCTCGAGCGTTGAAGAGTGCTCTCTTTGGTACACCCGCGCGGCCC
GACGACTCACCTCGACGGCAGGACACAAAGGCAAGCCGGCGGACCATGGCAAAGGAAGACAAGCCTTCATCGAGC
ACGCCTTCCAAGCCGCCCGGAATCCTCCTCACGCCCGGGACGGGCACCTCGCGACGGAAACGCGTCTCGTTTGGT
GCCGAAGCCGCCTCGACGGACAATGGCGCTGAGACGAGGTCAAAGGCCACGACCAAAGCTCGAGCTGTTGACCAG
GTTGTCACCGACGACTACGAGTCCGATGGAGAACGCATGGAGGCGCTGGCAAAGGCCAGGACCGAAGCTAGCGCC
ACTGGACCGAAAGTCATCGACGATTGCAGTTCCGACGCTGACTGGGAAGAGGAAAACGACGATGATGACGGCGGC
CTTTGCACGCACGACGTGACGCTGGATCTCAACGAGCCTCACTCGCAGTCTGGGCGGTACTGGAAGGGACAGTTC
GAGAGATATCATCAAGAAGCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTATGCC
CGGCAAAAGGACGCCGAGGCCCTCCGGCTGGCCGGGCGGCTCCGTGACGAGCGGCAGCGGGTCATCAAGATGGAA
AAGAAGATTGCAAACAACGCATCACAAATCGTCTCGAAGCACGACGACGACGATGGGGAGCCGACGGAACTACTG
GCAAAGCTCACCAAGCAGACTGCCCTCGCAGCCGAGTATCGACAGCGCGTGCACGAGCTCGAGACGGAGCTGGAC
GGGCTCGCGCGGCAGAAGGATCAAGGGGGCGAAGTCGGCGGTCGACGAAGGCGAGTGATGACGGCCGCCTCGCCG
ACGACACAGAAGACCTTGGTCGAGACACAGCGGGAACTCCGACGAGCGCGGACGCAACTGAAGGAATTGGACGGA
CTCCGCCACGAGGTATCCCTCCTCAAGGCTCGCGTCAAGACGGCCGAATCGCAGGCCAGCACGAGCAGCAACAAG
GGCGACGCCACCGAGGCCAAAGCCCGCAGACTGAGAAGCCATCTGGAGGAGTCGAGAGAGGAGACGAAACGAAAG
ACGGACGAGTTACGGCAGCTCAAGAAGGAGTTTGAGGCCTTTCGACGGGAGAGCGAAGCTCACGAGGCCGATACT
CGTGCCGTTCTCGAGCGGGCGCACGATAAGATTTCGGAGCTCAAGAGGGAGATGCGATGGCTTAGGACCGAAGCG
AACGGGGATCGCCGACGAGCCACTGATGGATGTGTATCGGGTGACGACGACGACGACGTCGACGACAACAACAAC
AACAACAACAACGACGACGCCCATCAGCCACGCCAAGACGGACGCAAGAAACGCGACAAGGACGACGCGTTGACG
GAACGGACCAACGGCCTGGCACCAAGATGGCAGCCATTTGTGGCCAGAAGCAGAGGCTCAACCGACTCAAACCCC
GAAACGGTACCCGTCCCACCGCGAAAGAACGATGACGATGGCGTCAAAAAATCCCGAGCTCGCAGCGCCCTCCCC
CCGGAACGTCGGGCAGCGGCGCTAGCCCGGATCGAGAGCCGGATGGAGGACAAGCGGCGGAGGGCACATGACAAG
GAGAACAGGCGGCCTGCGACGCACCTGAGCCTAGAATTATAG
Gene >Ophcf2|06800
ATGCTTGGATGGATGCTGCGGGGTGGCGAAAATGCGCCGAACGATGAAGCTCAGGGAGGTTCGTGCTGCTTTCCA
TGGGGAGCGGGCGTGCTGTGCGGCGATGCACGCTAAGATCAGGATCCTTCACAGACGCGACTCAGGTCGAGCAGC
CCGATACGCCTGCGCCCGTATTTGCGGCTCGAGCGTTGAAGAGTGCTCTCTTTGGTACACCCGCGCGGCCCGACG
ACTCACCTCGACGGCAGGACACAAAGGCAAGCCGGCGGACCATGGCAAAGGAAGACAAGCCTTCATCGAGCACGC
CTTCCAAGCCGCCCGGAATCCTCCTCACGCCCGGGACGGGCACCTCGCGACGGAAACGCGTCTCGTTTGGTGCCG
AAGCCGCCTCGACGGACAATGGCGCTGAGACGAGGTCAAAGGCCACGACCAAAGCTCGAGCTGTTGACCAGGTTG
TCACCGACGACTACGAGTCCGATGGAGAACGCATGGAGGCGCTGGCAAAGGCCAGGACCGAAGCTAGCGCCACTG
GACCGAAAGTCATCGACGATTGCAGTTCCGACGCTGACTGGGAAGAGGAAAACGACGATGATGACGGCGGCCTTT
GCACGCACGACGTGACGCTGGATCTCAACGAGCCTCACTCGCAGTCTGGGCGGTACTGGAAGGGACAGTTCGAGA
GATATCATCAAGAAGCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTATGCCCGGC
AAAAGGACGCCGAGGCCCTCCGGCTGGCCGGGCGGCTCCGTGACGAGCGGCAGCGGGTCATCAAGATGGAAAAGA
AGATTGCAAACAACGCATCACAAATCGTCTCGAAGCACGACGACGACGATGGGGAGCCGACGGAACTACTGGCAA
AGCTCACCAAGCAGACTGCCCTCGCAGCCGAGTATCGACAGCGCGTGCACGAGCTCGAGACGGAGCTGGACGGGC
TCGCGCGGCAGAAGGATCAAGGGGGCGAAGTCGGCGGTCGACGAAGGCGAGTGATGACGGCCGCCTCGCCGACGA
CACAGAAGACCTTGGTCGAGACACAGCGGGAACTCCGACGAGCGCGGACGCAACTGAAGGAATTGGACGGACTCC
GCCACGAGGTATCCCTCCTCAAGGCTCGCGTCAAGACGGCCGAATCGCAGGCCAGCACGAGCAGCAACAAGGGCG
ACGCCACCGAGGCCAAAGCCCGCAGACTGAGAAGCCATCTGGAGGAGTCGAGAGAGGAGACGAAACGAAAGACGG
ACGAGTTACGGCAGCTCAAGAAGGAGTTTGAGGCCTTTCGACGGGAGAGCGAAGCTCACGAGGCCGATACTCGTG
CCGTTCTCGAGCGGGCGCACGATAAGATTTCGGAGCTCAAGAGGGAGATGCGATGGCTTAGGACCGAAGCGAACG
GGGATCGCCGACGAGCCACTGATGGATGTGTATCGGGTGACGACGACGACGACGTCGACGACAACAACAACAACA
ACAACAACGACGACGCCCATCAGCCACGCCAAGACGGACGCAAGAAACGCGACAAGGACGACGCGTTGACGGAAC
GGACCAACGGCCTGGCACCAAGATGGCAGCCATTTGTGGCCAGAAGCAGAGGCTCAACCGACTCAAACCCCGAAA
CGGTACCCGTCCCACCGCGAAAGAACGATGACGATGGCGTCAAAAAATCCCGAGCTCGCAGCGCCCTCCCCCCGG
AACGTCGGGCAGCGGCGCTAGCCCGGATCGAGAGCCGGATGGAGGACAAGCGGCGGAGGGCACATGACAAGGAGA
ACAGGCGGCCTGCGACGCACCTGAGCCTAGAATTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail