Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06799
Gene name
Locationscaffold_08:1095024..1100159
Strand-
Gene length (bp)5135
Transcript length (bp)4770
Coding sequence length (bp)4770
Protein length (aa) 1590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.1E-20 305 533
PF00069 Pkinase Protein kinase domain 3.6E-12 581 647
PF00069 Pkinase Protein kinase domain 1.4E-35 768 960
PF12745 HGTP_anticodon2 Anticodon binding domain of tRNAs 5.8E-68 1356 1587
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.9E-14 310 485
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.4E-05 585 648
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 9.4E-20 768 959
PF13393 tRNA-synt_His Histidyl-tRNA synthetase 1.7E-17 1057 1335
PF05773 RWD RWD domain 3.7E-12 29 138

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0005515 protein binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0036211 protein modification process No
GO:0009987 cellular process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043412 macromolecule modification No
GO:0006793 phosphorus metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016310 phosphorylation No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6064 0.5191 0.1407 0.08 0.1403 0.044 0.0822 0.1694 0.1702 0.0146

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2459
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1334
Ophiocordyceps australis map64 (Brazil) OphauB2|6009
Ophiocordyceps camponoti-floridani Ophcf2|06799 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1127
Ophiocordyceps kimflemingae Ophio5|4131
Ophiocordyceps subramaniannii Hirsu2|3535

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06799
MASNGRDDKSFPGLKPARPDATAKTEYEEIQRNEMLVLEAIYGDDFVKHHHVAGAWKKAEPSFDITIKAPADSDL
AVTVGFVMTATYPKTPPILTVKSYENLREPTQLKIQHYVNTQPSIFAKEGQEMIDKIVEGIREILEEAAQALVSG
KLLPSLEAERQRHEADLARQARELEEEDERKRSQQTEEEEKAMSEMLQQELNRQRQKAKESKLSRRSHASAAQQP
NVASSEVDQIEFDQFCHTVDKAGDPFTFRSVSGKCDARDGPVSIVYTVRPVLEQGVSSQTMALKVAVVRSSGRDP
KDVKKQIQILESRLERVKVSKNLRHRHIVEVLDFKIEGRSWTDSATPSIWTVSVLTPLADKGSLEELLELAGNLE
LDKVRSWTRDLLDALGFLHNNSIAHQDVHAGNILLFRESTGEIVPKISDAWYQREIHHATARKQGLPGMSTARSA
YWLPPEIAAEAKPQYAYKTDIWDFGVVFLQMIFGCDVVQRYDSPNNLIESLTLSLPFHELVSLLFKEDKQKRPRA
FELSSSEFLATDAPVFCDAGADPLAPSPMTPSHPPKLRRESWNREDVVSRYTADFVEEGRLGKGGFGEVVKARKK
LDGQIYAIKKITLKTQASLTEMIKEVRLLSRLSHPAVVRYYNTWVEKAPDQVDDADQSTEGDAGETAVAGSVGVD
IQFTTSTGGLDFMSSNAPVEPDYEGSEDDVESDGDEADDDDDDDGDDDDGDDDDNEDDGDDDDMFTEGAVGFREG
RRGSSRPAKMRRPHRCIIYISMEYCEKRTLRDLISRNLYKNTAEIWRLFRQILEGLAHIHSLNIVHRDLKPENIF
ISGGKEELDNVKIGDFGLATSGQFSVDKVAANTLGTEDMTRSIGTAYYSAPEVRSTVDGMYSNKVDMYSLGVIFF
EMNYEPMLGMQKFEVIGNLRMETPLLPTDFKPADKTQTEIVLALVNHNPKERPSTTDLLKSGKLPVQMESETMRR
TLSGLSDPNSPYYSKMLSTLFARPMEPTRDYAWEMLASGPNPTELLRQSVAKGILTSIFRRHGALETRGSFVYPR
SPYYGDNVAQFLDQNGTVLQLPFDLTLGYARMVAKHPVGVARTFQFGTIFRDKKDTGQPQMFGEVDFDIVTSDTL
DLALKEAEVLKVLDEIVLAFPSLSTGQMCFHIGHSDLLRLIFEHCGIEPACRRAAADVLSKLHIHNNTWQKVRLE
LRSPAVGVSATSVDELQHFDFRDSPNKAFARLKTLFEGTDMYQRASSTVAHIKEVFEYAKRFGITTKVYVNPLNS
LKESFYVGGIMFSCLYDKKVRDVFAAGGRYDHLVKDQRPKIGGQPGERHAVGFSLAWERLAKVPKPSSRSAGKKQ
EDGFPGQRCDALVASFDPALLRSTGIDVLRMLWTHDVSAELARDARSPEDLQSKHRDENYSWIIVIKQDSMLKIK
TMSRSDVTDVDLPLTQLESWLSKQKSSNSPIAGSSGASTTPEGRDQNVKMLMAQTRSKKFNRQTIVEQAQSSAAN
LLTSFLQGPILAVETTDQVMDMMRSCRLSDAEAWRRLEQSVSSSERKYVREILEQLQACKLDHDGGAGARHSFVY
NFRTGSCLYLDLAD*
Coding >Ophcf2|06799
ATGGCTTCCAACGGGAGAGATGACAAGAGCTTCCCCGGTCTCAAGCCTGCCAGGCCGGATGCCACCGCCAAAACC
GAATATGAAGAGATTCAGAGAAACGAGATGCTGGTCCTCGAGGCCATTTATGGCGATGATTTCGTGAAGCATCAC
CACGTTGCCGGTGCTTGGAAGAAAGCCGAGCCGTCCTTCGATATCACCATCAAGGCGCCGGCCGACAGCGACTTG
GCCGTGACTGTTGGTTTTGTCATGACCGCGACGTATCCCAAGACACCGCCTATACTGACCGTCAAAAGCTATGAA
AATCTTCGCGAGCCCACCCAACTCAAGATCCAGCACTATGTGAACACGCAGCCATCCATCTTCGCCAAAGAAGGG
CAGGAGATGATTGACAAGATCGTCGAGGGAATTAGGGAAATCCTCGAAGAAGCCGCTCAGGCTCTTGTCTCGGGA
AAGCTGCTTCCCTCTCTCGAGGCCGAGCGTCAGCGTCATGAAGCAGACCTCGCCCGGCAGGCTCGCGAGCTTGAG
GAGGAAGACGAACGGAAACGGTCGCAGCAGACAGAGGAGGAAGAAAAGGCCATGTCTGAGATGCTACAGCAAGAG
CTCAATCGCCAGCGGCAAAAGGCAAAAGAGTCCAAGCTGAGCCGTCGCTCGCACGCGTCGGCTGCTCAACAGCCA
AATGTTGCCTCATCTGAAGTCGACCAGATAGAATTTGACCAGTTCTGTCACACGGTCGACAAGGCGGGAGATCCC
TTCACCTTTCGATCCGTCTCCGGCAAATGCGATGCTCGGGATGGTCCCGTCTCCATCGTGTACACCGTCCGCCCA
GTCCTCGAACAAGGCGTGTCGAGTCAGACCATGGCCCTGAAAGTAGCTGTCGTACGCTCGAGCGGCAGGGACCCC
AAAGACGTCAAGAAACAGATTCAAATTCTCGAATCTCGTTTGGAACGGGTCAAGGTTTCCAAGAACCTTCGTCAC
CGCCACATAGTCGAAGTCCTCGACTTCAAGATCGAGGGAAGGTCTTGGACCGACTCTGCGACACCCAGCATCTGG
ACCGTGAGCGTCCTCACTCCCCTCGCCGATAAGGGCTCATTGGAGGAGCTGTTGGAGCTCGCGGGCAATCTTGAA
CTCGACAAGGTCCGCTCTTGGACGAGGGATCTGCTGGATGCCCTCGGCTTTTTACACAACAACAGCATTGCTCAC
CAGGATGTTCATGCCGGGAATATCCTCCTCTTCCGCGAGTCGACGGGCGAAATCGTGCCCAAGATATCCGATGCC
TGGTATCAGAGGGAAATTCACCATGCCACCGCGCGGAAACAGGGTCTGCCCGGTATGAGCACCGCCAGATCCGCG
TACTGGCTGCCGCCGGAGATCGCTGCGGAAGCAAAGCCCCAATACGCGTACAAGACGGACATTTGGGACTTTGGC
GTCGTTTTCCTCCAAATGATCTTTGGTTGCGACGTCGTTCAGCGATATGACTCTCCCAATAACCTCATCGAGTCC
CTCACCCTCTCTTTGCCATTTCATGAGCTGGTGAGTCTTCTTTTCAAGGAGGACAAACAGAAACGGCCGCGGGCC
TTTGAGCTCAGTTCCAGCGAGTTTTTGGCAACTGACGCCCCTGTATTCTGCGATGCAGGGGCGGACCCGCTCGCG
CCTTCGCCCATGACGCCGTCACATCCCCCCAAGCTGCGGCGTGAGTCGTGGAATCGGGAAGACGTCGTCTCGCGC
TATACCGCCGACTTCGTAGAGGAAGGCCGGCTGGGCAAGGGAGGTTTCGGGGAGGTTGTCAAGGCACGGAAGAAG
CTCGACGGGCAGATCTATGCCATCAAAAAGATTACCCTCAAGACGCAAGCCAGCCTGACGGAGATGATCAAGGAG
GTCCGTCTGCTTTCGCGGCTGAGCCATCCGGCCGTGGTTCGATACTACAACACCTGGGTGGAGAAGGCCCCTGAT
CAGGTGGACGACGCGGATCAGTCGACCGAAGGCGACGCCGGTGAAACCGCAGTTGCGGGATCAGTGGGAGTCGAC
ATTCAGTTCACTACCAGCACGGGAGGCCTGGACTTCATGTCGTCCAATGCTCCGGTCGAGCCTGACTACGAAGGG
TCCGAGGATGACGTCGAAAGCGATGGAGACGAAGCTGACGATGATGACGACGACGATGGGGACGACGACGATGGG
GACGACGACGACAATGAGGATGACGGGGATGACGACGACATGTTCACTGAGGGCGCTGTGGGCTTTCGTGAGGGT
AGACGCGGCTCCTCGCGGCCCGCCAAGATGCGCAGACCGCATAGATGCATCATCTACATCTCGATGGAGTATTGT
GAGAAACGGACGCTCCGGGATCTCATCTCGCGCAACCTGTACAAGAACACGGCTGAGATTTGGCGGCTCTTTCGG
CAGATACTCGAGGGCCTGGCTCACATTCATAGCCTGAACATTGTCCACCGCGATCTGAAGCCGGAGAACATCTTC
ATTAGCGGCGGCAAAGAAGAATTGGACAATGTCAAGATTGGCGACTTTGGCTTGGCCACGAGCGGACAGTTTTCG
GTCGATAAGGTGGCCGCTAACACGCTGGGCACCGAGGACATGACGAGGAGCATCGGAACGGCCTATTATTCGGCA
CCCGAGGTTCGCTCGACCGTTGACGGCATGTACAGTAACAAAGTCGATATGTACTCGTTGGGCGTCATCTTCTTT
GAGATGAATTACGAGCCGATGCTTGGGATGCAAAAGTTCGAGGTTATCGGCAACCTTCGGATGGAGACGCCCCTG
CTTCCCACCGACTTCAAGCCCGCAGACAAGACGCAGACGGAGATTGTCCTGGCCCTCGTCAACCACAACCCCAAG
GAGAGGCCGTCGACGACGGACCTGCTGAAGAGCGGCAAGTTGCCGGTCCAGATGGAGAGCGAGACGATGCGTCGT
ACGCTGTCGGGCCTTTCGGATCCCAACTCTCCGTACTACAGCAAGATGCTCAGCACGCTCTTTGCACGGCCCATG
GAGCCAACGAGGGACTACGCGTGGGAGATGCTGGCGAGCGGGCCTAATCCGACGGAGCTTCTTCGCCAGAGCGTC
GCCAAGGGCATCCTGACATCCATCTTCCGCCGGCACGGGGCGCTCGAGACGCGCGGCAGCTTCGTCTATCCTCGA
TCGCCCTACTATGGCGACAACGTGGCCCAGTTCCTGGATCAGAACGGTACGGTGCTCCAGCTTCCCTTCGATCTG
ACGCTCGGATACGCCCGAATGGTGGCCAAGCACCCGGTAGGCGTGGCGAGGACCTTTCAGTTCGGCACCATCTTT
CGAGACAAGAAGGACACGGGACAGCCGCAGATGTTTGGCGAGGTGGACTTTGACATCGTCACGAGCGACACGCTA
GACCTGGCACTTAAGGAGGCCGAGGTTCTAAAGGTGCTGGACGAGATCGTACTGGCCTTTCCTTCGCTGTCGACG
GGCCAGATGTGCTTTCACATCGGCCACTCGGACCTGTTGCGGCTCATCTTTGAGCACTGCGGCATCGAGCCGGCC
TGCAGACGGGCAGCGGCCGACGTGCTGAGCAAGCTGCATATCCATAACAACACCTGGCAAAAGGTGAGATTGGAG
TTGCGGTCTCCCGCAGTCGGCGTCTCGGCGACGAGCGTCGACGAGCTTCAGCACTTCGACTTTCGAGACTCGCCC
AACAAGGCCTTTGCGAGGCTCAAGACGCTGTTCGAGGGCACCGACATGTACCAGCGCGCGTCATCGACGGTGGCG
CACATCAAAGAGGTGTTCGAGTACGCCAAGCGGTTCGGAATCACGACCAAAGTCTACGTCAACCCTCTCAACAGC
CTCAAGGAGAGCTTCTACGTCGGGGGCATCATGTTCTCGTGCCTATACGACAAAAAGGTCAGGGACGTCTTCGCC
GCCGGCGGCCGATACGACCACTTGGTAAAGGACCAGCGGCCCAAGATCGGCGGCCAGCCGGGCGAGAGACACGCC
GTGGGATTCAGCCTCGCCTGGGAGAGGCTAGCCAAGGTTCCCAAGCCGAGCAGTCGGTCGGCGGGCAAGAAGCAG
GAAGACGGATTCCCGGGCCAGAGGTGTGACGCCCTGGTGGCCAGCTTCGACCCGGCCCTGCTCCGATCCACGGGC
ATCGACGTGCTGCGGATGCTGTGGACGCACGACGTCAGCGCCGAGCTGGCCCGTGACGCCCGGTCTCCCGAAGAT
CTACAGTCGAAGCACCGAGACGAGAACTACTCGTGGATCATCGTCATCAAGCAAGACTCGATGCTCAAGATCAAG
ACGATGAGCCGCAGCGACGTCACGGACGTCGACCTCCCCCTGACGCAGCTCGAATCCTGGCTAAGCAAGCAGAAA
AGCAGCAACAGCCCGATAGCCGGCTCAAGCGGCGCAAGCACCACCCCCGAAGGCCGCGACCAAAACGTCAAGATG
CTCATGGCCCAAACCCGCAGCAAGAAATTCAACCGGCAAACCATCGTCGAACAAGCCCAATCCAGCGCAGCCAAC
CTCCTAACCTCCTTCCTCCAGGGCCCCATCCTGGCCGTCGAGACGACAGATCAGGTCATGGACATGATGCGCTCG
TGCCGCCTCTCCGACGCCGAAGCCTGGCGCCGCCTCGAACAGTCCGTCTCCTCGTCCGAGAGGAAATACGTCCGC
GAGATCCTCGAGCAGCTTCAGGCCTGCAAGCTCGACCATGATGGCGGCGCCGGCGCCAGGCATTCCTTCGTCTAT
AACTTTCGCACCGGGTCTTGTCTCTACCTTGATCTGGCGGACTGA
Transcript >Ophcf2|06799
ATGGCTTCCAACGGGAGAGATGACAAGAGCTTCCCCGGTCTCAAGCCTGCCAGGCCGGATGCCACCGCCAAAACC
GAATATGAAGAGATTCAGAGAAACGAGATGCTGGTCCTCGAGGCCATTTATGGCGATGATTTCGTGAAGCATCAC
CACGTTGCCGGTGCTTGGAAGAAAGCCGAGCCGTCCTTCGATATCACCATCAAGGCGCCGGCCGACAGCGACTTG
GCCGTGACTGTTGGTTTTGTCATGACCGCGACGTATCCCAAGACACCGCCTATACTGACCGTCAAAAGCTATGAA
AATCTTCGCGAGCCCACCCAACTCAAGATCCAGCACTATGTGAACACGCAGCCATCCATCTTCGCCAAAGAAGGG
CAGGAGATGATTGACAAGATCGTCGAGGGAATTAGGGAAATCCTCGAAGAAGCCGCTCAGGCTCTTGTCTCGGGA
AAGCTGCTTCCCTCTCTCGAGGCCGAGCGTCAGCGTCATGAAGCAGACCTCGCCCGGCAGGCTCGCGAGCTTGAG
GAGGAAGACGAACGGAAACGGTCGCAGCAGACAGAGGAGGAAGAAAAGGCCATGTCTGAGATGCTACAGCAAGAG
CTCAATCGCCAGCGGCAAAAGGCAAAAGAGTCCAAGCTGAGCCGTCGCTCGCACGCGTCGGCTGCTCAACAGCCA
AATGTTGCCTCATCTGAAGTCGACCAGATAGAATTTGACCAGTTCTGTCACACGGTCGACAAGGCGGGAGATCCC
TTCACCTTTCGATCCGTCTCCGGCAAATGCGATGCTCGGGATGGTCCCGTCTCCATCGTGTACACCGTCCGCCCA
GTCCTCGAACAAGGCGTGTCGAGTCAGACCATGGCCCTGAAAGTAGCTGTCGTACGCTCGAGCGGCAGGGACCCC
AAAGACGTCAAGAAACAGATTCAAATTCTCGAATCTCGTTTGGAACGGGTCAAGGTTTCCAAGAACCTTCGTCAC
CGCCACATAGTCGAAGTCCTCGACTTCAAGATCGAGGGAAGGTCTTGGACCGACTCTGCGACACCCAGCATCTGG
ACCGTGAGCGTCCTCACTCCCCTCGCCGATAAGGGCTCATTGGAGGAGCTGTTGGAGCTCGCGGGCAATCTTGAA
CTCGACAAGGTCCGCTCTTGGACGAGGGATCTGCTGGATGCCCTCGGCTTTTTACACAACAACAGCATTGCTCAC
CAGGATGTTCATGCCGGGAATATCCTCCTCTTCCGCGAGTCGACGGGCGAAATCGTGCCCAAGATATCCGATGCC
TGGTATCAGAGGGAAATTCACCATGCCACCGCGCGGAAACAGGGTCTGCCCGGTATGAGCACCGCCAGATCCGCG
TACTGGCTGCCGCCGGAGATCGCTGCGGAAGCAAAGCCCCAATACGCGTACAAGACGGACATTTGGGACTTTGGC
GTCGTTTTCCTCCAAATGATCTTTGGTTGCGACGTCGTTCAGCGATATGACTCTCCCAATAACCTCATCGAGTCC
CTCACCCTCTCTTTGCCATTTCATGAGCTGGTGAGTCTTCTTTTCAAGGAGGACAAACAGAAACGGCCGCGGGCC
TTTGAGCTCAGTTCCAGCGAGTTTTTGGCAACTGACGCCCCTGTATTCTGCGATGCAGGGGCGGACCCGCTCGCG
CCTTCGCCCATGACGCCGTCACATCCCCCCAAGCTGCGGCGTGAGTCGTGGAATCGGGAAGACGTCGTCTCGCGC
TATACCGCCGACTTCGTAGAGGAAGGCCGGCTGGGCAAGGGAGGTTTCGGGGAGGTTGTCAAGGCACGGAAGAAG
CTCGACGGGCAGATCTATGCCATCAAAAAGATTACCCTCAAGACGCAAGCCAGCCTGACGGAGATGATCAAGGAG
GTCCGTCTGCTTTCGCGGCTGAGCCATCCGGCCGTGGTTCGATACTACAACACCTGGGTGGAGAAGGCCCCTGAT
CAGGTGGACGACGCGGATCAGTCGACCGAAGGCGACGCCGGTGAAACCGCAGTTGCGGGATCAGTGGGAGTCGAC
ATTCAGTTCACTACCAGCACGGGAGGCCTGGACTTCATGTCGTCCAATGCTCCGGTCGAGCCTGACTACGAAGGG
TCCGAGGATGACGTCGAAAGCGATGGAGACGAAGCTGACGATGATGACGACGACGATGGGGACGACGACGATGGG
GACGACGACGACAATGAGGATGACGGGGATGACGACGACATGTTCACTGAGGGCGCTGTGGGCTTTCGTGAGGGT
AGACGCGGCTCCTCGCGGCCCGCCAAGATGCGCAGACCGCATAGATGCATCATCTACATCTCGATGGAGTATTGT
GAGAAACGGACGCTCCGGGATCTCATCTCGCGCAACCTGTACAAGAACACGGCTGAGATTTGGCGGCTCTTTCGG
CAGATACTCGAGGGCCTGGCTCACATTCATAGCCTGAACATTGTCCACCGCGATCTGAAGCCGGAGAACATCTTC
ATTAGCGGCGGCAAAGAAGAATTGGACAATGTCAAGATTGGCGACTTTGGCTTGGCCACGAGCGGACAGTTTTCG
GTCGATAAGGTGGCCGCTAACACGCTGGGCACCGAGGACATGACGAGGAGCATCGGAACGGCCTATTATTCGGCA
CCCGAGGTTCGCTCGACCGTTGACGGCATGTACAGTAACAAAGTCGATATGTACTCGTTGGGCGTCATCTTCTTT
GAGATGAATTACGAGCCGATGCTTGGGATGCAAAAGTTCGAGGTTATCGGCAACCTTCGGATGGAGACGCCCCTG
CTTCCCACCGACTTCAAGCCCGCAGACAAGACGCAGACGGAGATTGTCCTGGCCCTCGTCAACCACAACCCCAAG
GAGAGGCCGTCGACGACGGACCTGCTGAAGAGCGGCAAGTTGCCGGTCCAGATGGAGAGCGAGACGATGCGTCGT
ACGCTGTCGGGCCTTTCGGATCCCAACTCTCCGTACTACAGCAAGATGCTCAGCACGCTCTTTGCACGGCCCATG
GAGCCAACGAGGGACTACGCGTGGGAGATGCTGGCGAGCGGGCCTAATCCGACGGAGCTTCTTCGCCAGAGCGTC
GCCAAGGGCATCCTGACATCCATCTTCCGCCGGCACGGGGCGCTCGAGACGCGCGGCAGCTTCGTCTATCCTCGA
TCGCCCTACTATGGCGACAACGTGGCCCAGTTCCTGGATCAGAACGGTACGGTGCTCCAGCTTCCCTTCGATCTG
ACGCTCGGATACGCCCGAATGGTGGCCAAGCACCCGGTAGGCGTGGCGAGGACCTTTCAGTTCGGCACCATCTTT
CGAGACAAGAAGGACACGGGACAGCCGCAGATGTTTGGCGAGGTGGACTTTGACATCGTCACGAGCGACACGCTA
GACCTGGCACTTAAGGAGGCCGAGGTTCTAAAGGTGCTGGACGAGATCGTACTGGCCTTTCCTTCGCTGTCGACG
GGCCAGATGTGCTTTCACATCGGCCACTCGGACCTGTTGCGGCTCATCTTTGAGCACTGCGGCATCGAGCCGGCC
TGCAGACGGGCAGCGGCCGACGTGCTGAGCAAGCTGCATATCCATAACAACACCTGGCAAAAGGTGAGATTGGAG
TTGCGGTCTCCCGCAGTCGGCGTCTCGGCGACGAGCGTCGACGAGCTTCAGCACTTCGACTTTCGAGACTCGCCC
AACAAGGCCTTTGCGAGGCTCAAGACGCTGTTCGAGGGCACCGACATGTACCAGCGCGCGTCATCGACGGTGGCG
CACATCAAAGAGGTGTTCGAGTACGCCAAGCGGTTCGGAATCACGACCAAAGTCTACGTCAACCCTCTCAACAGC
CTCAAGGAGAGCTTCTACGTCGGGGGCATCATGTTCTCGTGCCTATACGACAAAAAGGTCAGGGACGTCTTCGCC
GCCGGCGGCCGATACGACCACTTGGTAAAGGACCAGCGGCCCAAGATCGGCGGCCAGCCGGGCGAGAGACACGCC
GTGGGATTCAGCCTCGCCTGGGAGAGGCTAGCCAAGGTTCCCAAGCCGAGCAGTCGGTCGGCGGGCAAGAAGCAG
GAAGACGGATTCCCGGGCCAGAGGTGTGACGCCCTGGTGGCCAGCTTCGACCCGGCCCTGCTCCGATCCACGGGC
ATCGACGTGCTGCGGATGCTGTGGACGCACGACGTCAGCGCCGAGCTGGCCCGTGACGCCCGGTCTCCCGAAGAT
CTACAGTCGAAGCACCGAGACGAGAACTACTCGTGGATCATCGTCATCAAGCAAGACTCGATGCTCAAGATCAAG
ACGATGAGCCGCAGCGACGTCACGGACGTCGACCTCCCCCTGACGCAGCTCGAATCCTGGCTAAGCAAGCAGAAA
AGCAGCAACAGCCCGATAGCCGGCTCAAGCGGCGCAAGCACCACCCCCGAAGGCCGCGACCAAAACGTCAAGATG
CTCATGGCCCAAACCCGCAGCAAGAAATTCAACCGGCAAACCATCGTCGAACAAGCCCAATCCAGCGCAGCCAAC
CTCCTAACCTCCTTCCTCCAGGGCCCCATCCTGGCCGTCGAGACGACAGATCAGGTCATGGACATGATGCGCTCG
TGCCGCCTCTCCGACGCCGAAGCCTGGCGCCGCCTCGAACAGTCCGTCTCCTCGTCCGAGAGGAAATACGTCCGC
GAGATCCTCGAGCAGCTTCAGGCCTGCAAGCTCGACCATGATGGCGGCGCCGGCGCCAGGCATTCCTTCGTCTAT
AACTTTCGCACCGGGTCTTGTCTCTACCTTGATCTGGCGGACTGA
Gene >Ophcf2|06799
ATGGCTTCCAACGGGAGAGATGACAAGAGCTTCCCCGGTCTCAAGCCTGCCAGGCCGGATGCCACCGCCAAAACC
GAATATGAAGAGATTCAGAGAAACGAGATGCTGGTCCTCGAGGCCATTTATGGCGATGATTTCGTGAAGCATCAC
CACGTTGCCGGTGCTTGGAAGGTTCGTTTTCTCATTTTCCCCTTGGGAAGACTATCTCGACTTCTCATCTCATGT
ATCCTTTCTCTTTCCTCTTTTCTCCTTTCTCTCATCCTCGTCTTCGCCCTGCTCACCATCTCGTCTCTAGAAAGC
CGAGCCGTCCTTCGATATCACCATCAAGGCGCCGGCCGACAGCGACTTGGCCGTGACTGTTGGTTTTGTCATGAC
CGCGACGTATCCCAAGACACCGCCTATACTGACCGTCAAAAGCTATGAAAATCTTCGCGAGCCCACCCAACTCAA
GATCCAGCACTATGTGAACACGCAGCCATCCATCTTCGCCAAAGAAGGGCAGGAGATGATTGACAAGATCGTCGA
GGGAATTAGGGAAATCCTCGAAGAAGCCGCTCAGGCTCTTGTCTCGGGAAAGCTGCTTCCCTCTCTCGAGGCCGA
GCGTCAGCGTCATGAAGCAGACCTCGCCCGGCAGGCTCGCGAGCTTGAGGAGGAAGACGAACGGAAACGGTCGCA
GCAGACAGAGGAGGAAGAAAAGGCCATGTCTGAGATGCTACAGCAAGAGCTCAATCGCCAGCGGCAAAAGGCAAA
AGAGTCCAAGCTGAGCCGTCGCTCGCACGCGTCGGCTGCTCAACAGCCAAATGTTGCCTCATCTGAAGTCGACCA
GATAGAATTTGACCAGTTCTGTCACACGGTCGACAAGGCGGGAGATCCCTTCACCTTTCGATCCGTCTCCGGCAA
ATGCGATGCTCGGGATGGTCCCGTCTCCATCGTGTACACCGTCCGCCCAGTCCTCGAACAAGGCGTGTCGAGTCA
GACCATGGCCCTGAAAGTAGCTGTCGTACGCTCGAGCGGCAGGGACCCCAAAGACGTCAAGAAACAGATTCAAAT
TCTCGAATCTCGTTTGGAACGGGTCAAGGTTTCCAAGAACCTTCGTCACCGCCACATAGTCGAAGTCCTCGACTT
CAAGATCGAGGGAAGGTCTTGGACCGACTCTGCGACACCCAGCATCTGGACCGTGAGCGTCCTCACTCCCCTCGC
CGATAAGGGCTCATTGGAGGAGCTGTTGGAGCTCGCGGGCAATCTTGAACTCGACAAGGTCCGCTCTTGGACGAG
GGATCTGCTGGATGCCCTCGGCTTTTTACACAACAACAGCATTGCTCACCAGGATGTTCATGCCGGGAATATCCT
CCTCTTCCGCGAGTCGACGGGCGAAATCGTGCCCAAGATATCCGATGCCTGGTATCAGAGGGAAATTCACCATGC
CACCGCGCGGAAACAGGGTCTGCCCGGTATGAGCACCGCCAGATCCGCGTACTGGCTGCCGCCGGAGATCGCTGC
GGAAGCAAAGCCCCAATACGCGTACAAGACGGACATTTGGGACTTTGGCGTCGTTTTCCTCCAAATGATCTTTGG
TTGCGACGTCGTTCAGCGATATGACTCTCCCAATAACCTCATCGAGTCCCTCACCCTCTCTTTGCCATTTCATGA
GCTGGTGAGTCTTCTTTTCAAGGAGGACAAACAGAAACGGCCGCGGGCCTTTGAGCTCAGTTCCAGCGAGTTTTT
GGCAACTGACGCCCCTGTATTCTGCGATGCAGGGGCGGACCCGCTCGCGCCTTCGCCCATGACGCCGTCACATCC
CCCCAAGCTGCGGCGTGAGTCGTGGAATCGGGAAGACGTCGTCTCGCGCTATACCGCCGACTTCGTAGAGGAAGG
CCGGCTGGGCAAGGGAGGTTTCGGGGAGGTTGTCAAGGCACGGAAGAAGCTCGACGGGCAGATCTATGCCATCAA
AAAGATTACCCTCAAGACGCAAGCCAGCCTGACGGAGATGATCAAGGAGGTCCGTCTGCTTTCGCGGCTGAGCCA
TCCGGCCGTGGTTCGATACTACAACACCTGGGTGGAGAAGGCCCCTGATCAGGTGGACGACGCGGATCAGTCGAC
CGAAGGCGACGCCGGTGAAACCGCAGTTGCGGGATCAGTGGGAGTCGACATTCAGTTCACTACCAGCACGGGAGG
CCTGGACTTCATGTCGTCCAATGCTCCGGTCGAGCCTGACTACGAAGGGTCCGAGGATGACGTCGAAAGCGATGG
AGACGAAGCTGACGATGATGACGACGACGATGGGGACGACGACGATGGGGACGACGACGACAATGAGGATGACGG
GGATGACGACGACATGTTCACTGAGGGCGCTGTGGGCTTTCGTGAGGGTAGACGCGGCTCCTCGCGGCCCGCCAA
GATGCGCAGACCGCATAGATGCATCATCTACATCTCGATGGAGTATTGTGAGAAACGGGTATGTCGTGCTGAATC
CTCGCGCATCTATGCTCCTGCTGACTCTTTCAGACGCTCCGGGATCTCATCTCGCGCAACCTGTACAAGAACACG
GCTGAGATTTGGCGGCTCTTTCGGCAGATACTCGAGGGCCTGGCTCACATTCATAGCCTGAACATTGTCCACCGC
GATCTGAAGCCGGAGAACATCTTCATTAGCGGCGGCAAAGAAGAATTGGACAATGTCAAGATTGGCGACTTTGGC
TTGGCCACGAGCGGACAGTTTTCGGTCGATAAGGTGGCCGCTAACACGCTGGGCACCGAGGACATGACGAGGAGC
ATCGGAACGGCCTATTATTCGGCACCCGAGGTTCGCTCGACCGTTGACGGCATGTACAGTAACAAAGTCGATGTG
AGTCGATCCCAGGCTTGGCCACTCTAGAGGCTCGAGAGGTGCTGACCTTTGTCCAGATGTACTCGTTGGGCGTCA
TCTTCTTTGAGATGAATTACGAGCCGATGCTTGGGATGCAAAAGTTCGAGGTTATCGGCAACCTTCGGATGGAGA
CGCCCCTGCTTCCCACCGACTTCAAGCCCGCAGACAAGACGCAGACGGAGATTGTCCTGGCCCTCGTCAACCACA
ACCCCAAGGAGAGGCCGTCGACGACGGACCTGCTGAAGAGCGGCAAGTTGCCGGTCCAGATGGAGAGCGAGACGA
TGCGTCGTACGCTGTCGGGCCTTTCGGATCCCAACTCTCCGTACTACAGCAAGATGCTCAGCACGCTCTTTGCAC
GGCCCATGGAGCCAACGAGGGACTACGCGTGGGAGATGCTGGCGAGCGGGCCTAATCCGACGGAGCTTCTTCGCC
AGAGCGTCGCCAAGGGCATCCTGACATCCATCTTCCGCCGGCACGGGGCGCTCGAGACGCGCGGCAGCTTCGTCT
ATCCTCGATCGCCCTACTATGGCGACAACGTGGCCCAGTTCCTGGATCAGAACGGTACGGTGCTCCAGCTTCCCT
TCGATCTGACGCTCGGATACGCCCGAATGGTGGCCAAGCACCCGGTAGGCGTGGCGAGGACCTTTCAGTTCGGCA
CCATCTTTCGAGACAAGAAGGACACGGGACAGCCGCAGATGTTTGGCGAGGTGGACTTTGACATCGTCACGAGCG
ACACGCTAGACCTGGCACTTAAGGAGGCCGAGGTTCTAAAGGTGCTGGACGAGATCGTACTGGCCTTTCCTTCGC
TGTCGACGGGCCAGATGTGCTTTCACATCGGCCACTCGGACCTGTTGCGGCTCATCTTTGAGCACTGCGGCATCG
AGCCGGCCTGCAGACGGGCAGCGGCCGACGTGCTGAGCAAGCTGCATATCCATAACAACACCTGGCAAAAGGTGA
GATTGGAGTTGCGGTCTCCCGCAGTCGGCGTCTCGGCGACGAGCGTCGACGAGCTTCAGCACTTCGACTTTCGAG
GTAAGCACGATGCTTTTGATCCCGAGACTTGGCCACGACGCATGCTGACACCCAGATGACAAGACTCGCCCAACA
AGGCCTTTGCGAGGCTCAAGACGCTGTTCGAGGGCACCGACATGTACCAGCGCGCGTCATCGACGGTGGCGCACA
TCAAAGAGGTGTTCGAGTACGCCAAGCGGTTCGGAATCACGACCAAAGTCTACGTCAACCCTCTCAACAGCCTCA
AGGAGAGCTTCTACGTCGGGGGCATCATGTTCTCGTGCCTATACGACAAAAAGGTCAGGGACGTCTTCGCCGCCG
GCGGCCGATACGACCACTTGGTAAAGGACCAGCGGCCCAAGATCGGCGGCCAGCCGGGCGAGAGACACGCCGTGG
GATTCAGCCTCGCCTGGGAGAGGCTAGCCAAGGTTCCCAAGCCGAGCAGTCGGTCGGCGGGCAAGAAGCAGGAAG
ACGGATTCCCGGGCCAGAGGGTTGAGTCTTCCTCCAGCCCCTCCGAATCGGAGACGGAAGTCGGCCATGACCAGC
TGACGGCCCCTCAGTGTGACGCCCTGGTGGCCAGCTTCGACCCGGCCCTGCTCCGATCCACGGGCATCGACGTGC
TGCGGATGCTGTGGACGCACGACGTCAGCGCCGAGCTGGCCCGTGACGCCCGGTCTCCCGAAGATCTACAGTCGA
AGCACCGAGACGAGAACTACTCGTGGATCATCGTCATCAAGCAAGACTCGATGCTCAAGATCAAGACGATGAGCC
GCAGCGACGTCACGGACGTCGACCTCCCCCTGACGCAGCTCGAATCCTGGCTAAGCAAGCAGAAAAGCAGCAACA
GCCCGATAGCCGGCTCAAGCGGCGCAAGCACCACCCCCGAAGGCCGCGACCAAAACGTCAAGATGCTCATGGCCC
AAACCCGCAGCAAGAAATTCAACCGGCAAACCATCGTCGAACAAGCCCAATCCAGCGCAGCCAACCTCCTAACCT
CCTTCCTCCAGGGCCCCATCCTGGCCGTCGAGACGACAGATCAGGTCATGGACATGATGCGCTCGTGCCGCCTCT
CCGACGCCGAAGCCTGGCGCCGCCTCGAACAGTCCGTCTCCTCGTCCGAGAGGAAATACGTCCGCGAGATCCTCG
AGCAGCTTCAGGCCTGCAAGCTCGACCATGATGGCGGCGCCGGCGCCAGGCATTCCTTCGTCTATAACTTTCGCA
CCGGGTCTTGTCTCTACCTTGATCTGGCGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail