Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06791
Gene name
Locationscaffold_08:1072144..1072954
Strand-
Gene length (bp)810
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 1.6E-20 9 203
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.9E-06 6 187

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8774 0.5134 0.1366 0.072 0.3013 0.1779 0.1244 0.033 0.0922 0.0507

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2267
Ophiocordyceps australis map64 (Brazil) OphauB2|6005
Ophiocordyceps camponoti-floridani Ophcf2|06791 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6209
Ophiocordyceps kimflemingae Ophio5|6811
Ophiocordyceps subramaniannii Hirsu2|10371
Ophiocordyceps subramaniannii Hirsu2|3539
Ophiocordyceps subramaniannii Hirsu2|5668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06791
MAPRKITTLLFDCDNTLVLSEELAFEACADLINKICSERGINKHFTGSSLITEFVGQNFRGMLTTLQRENGIDII
PDDMEKYVRMEEDAVIAKLKASLRPCDGVDAQLKELDASGKYLMAVVSSSAFRRLRASIEKVGQEKYFPDDRVFS
AATSLDKPTSKPDPAVYLHALKKLGRTAEESVAIEDSKSGTLSGTRAQIKVVGYVGPYPDDKKAEMEKVLRDAGA
VVIMRDWSEFPACLKKIEAGEC*
Coding >Ophcf2|06791
ATGGCTCCCCGCAAAATCACAACCCTCCTCTTCGACTGCGACAACACCCTCGTCCTCTCCGAGGAACTCGCCTTC
GAAGCCTGCGCCGACCTCATCAACAAGATCTGCTCCGAGCGCGGCATCAACAAACACTTCACCGGCTCCTCCCTC
ATCACCGAATTCGTCGGCCAGAACTTCAGAGGCATGCTCACCACGCTCCAGCGCGAAAACGGCATCGACATCATC
CCGGACGATATGGAAAAGTACGTTCGCATGGAGGAAGATGCCGTCATCGCCAAGCTCAAGGCCTCGCTTCGTCCC
TGTGACGGTGTCGATGCTCAGCTCAAGGAGCTGGATGCTTCGGGAAAATATCTCATGGCCGTGGTCTCCTCGTCG
GCTTTCCGTCGTCTTCGCGCTTCCATCGAAAAGGTCGGCCAGGAAAAGTACTTTCCTGACGATCGCGTCTTCTCC
GCGGCTACCAGTTTGGACAAGCCGACTAGCAAGCCCGATCCCGCCGTTTATCTGCACGCCCTCAAGAAGCTGGGT
CGCACGGCGGAGGAGAGCGTCGCCATTGAGGATAGCAAGAGCGGGACTCTCAGCGGGACGCGTGCTCAGATCAAG
GTCGTCGGCTACGTTGGGCCCTACCCGGATGACAAAAAGGCCGAGATGGAAAAGGTGCTGCGCGATGCGGGCGCC
GTCGTCATCATGCGTGACTGGTCCGAGTTTCCGGCCTGTCTGAAGAAGATTGAGGCTGGCGAGTGCTAG
Transcript >Ophcf2|06791
ATGGCTCCCCGCAAAATCACAACCCTCCTCTTCGACTGCGACAACACCCTCGTCCTCTCCGAGGAACTCGCCTTC
GAAGCCTGCGCCGACCTCATCAACAAGATCTGCTCCGAGCGCGGCATCAACAAACACTTCACCGGCTCCTCCCTC
ATCACCGAATTCGTCGGCCAGAACTTCAGAGGCATGCTCACCACGCTCCAGCGCGAAAACGGCATCGACATCATC
CCGGACGATATGGAAAAGTACGTTCGCATGGAGGAAGATGCCGTCATCGCCAAGCTCAAGGCCTCGCTTCGTCCC
TGTGACGGTGTCGATGCTCAGCTCAAGGAGCTGGATGCTTCGGGAAAATATCTCATGGCCGTGGTCTCCTCGTCG
GCTTTCCGTCGTCTTCGCGCTTCCATCGAAAAGGTCGGCCAGGAAAAGTACTTTCCTGACGATCGCGTCTTCTCC
GCGGCTACCAGTTTGGACAAGCCGACTAGCAAGCCCGATCCCGCCGTTTATCTGCACGCCCTCAAGAAGCTGGGT
CGCACGGCGGAGGAGAGCGTCGCCATTGAGGATAGCAAGAGCGGGACTCTCAGCGGGACGCGTGCTCAGATCAAG
GTCGTCGGCTACGTTGGGCCCTACCCGGATGACAAAAAGGCCGAGATGGAAAAGGTGCTGCGCGATGCGGGCGCC
GTCGTCATCATGCGTGACTGGTCCGAGTTTCCGGCCTGTCTGAAGAAGATTGAGGCTGGCGAGTGCTAG
Gene >Ophcf2|06791
ATGGCTCCCGTACGTTCCTCCTCTCCCCCACTGCTTCTACCCCCAAATCTAACTCCCCCCCCCCCTCCCTCCCAG
CGCAAAATCACAACCCTCCTCTTCGACTGCGACAACACCCTCGTCCTCTCCGAGGAACTCGCCTTCGAAGCCTGC
GCCGACCTCATCAACAAGATCTGCTCCGAGCGCGGCATCAACAAACACTTCACCGGCTCCTCCCTCATCACCGAA
TTCGTCGGCCAGAACTTCAGAGGCATGCTCACCACGCTCCAGCGCGAAAACGGCATCGACATCATCCCGGACGAT
ATGGAAAAGTACGTTCGCATGGAGGAAGATGCCGTCATCGCCAAGCTCAAGGCCTCGCTTCGTCCCTGTGACGGT
GTCGATGCTCAGCTCAAGGAGCTGGATGCTTCGGGAAAATATCTCATGGCCGTGGTCTCCTCGTCGGCTTTCCGT
CGTCTTCGCGCTTCCATCGAAAAGGTCGGCCAGGAAAAGTACTTTCCTGACGATCGCGTCTTCTCCGCGGCTACC
AGTTTGGACAAGCCGACTAGCAAGCCCGATCCCGCCGTTTATCTGCACGCCCTCAAGAAGCTGGGTCGCACGGCG
GAGGAGAGCGTCGCCATTGAGGATAGCAAGAGCGGGACTCTCAGCGGGACGCGTGCTCAGATCAAGGTCGTCGGC
TACGTTGGGCCCTACCCGGATGACAAAAAGGCCGAGATGGAAAAGGTGCTGCGCGATGCGGGCGCCGTCGTCATC
ATGCGTGACTGGTCCGAGTTTCCGGCCTGTCTGAAGAAGATTGAGGCTGGCGAGTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail