Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06788
Gene name
Locationscaffold_08:1065704..1067427
Strand-
Gene length (bp)1723
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.3E-39 59 455
PF00083 Sugar_tr Sugar (and other) transporter 2.8E-15 57 221

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 86 108 22
3 118 137 19
4 144 166 22
5 176 198 22
6 240 262 22
7 272 294 22
8 315 337 22
9 352 369 17
10 376 395 19
11 410 432 22
12 445 467 22
13 513 535 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06788
MASNGAQNSHERSPLIQPDARVHVPQPVQGNGDDDDDERTVVAKQLPFPRLAFIMGTAWLGVFLGAIDSTVIATL
SASIASEFKSLSLLSWLATAYLISTAACQPISGRLTDIFGRGTGLIFSNLFFAAGNLICGLAQDDSTMILGRIIA
GIGGGGLMSISTFLGSDLIPLRNRGIAQGIGNICYGSGAMLGSVFGGLMNDRTSWGWRLAFLIQVPPVLFSAVTA
AILVKVPPKQSKKSLLARIDFVGVLLTTSFLVILLLGLNSGGNIVPWTHPLPLVTIPLSFVIFAGFLWWESRARQ
PIIPIKLLMVRTVLAACVCNLLCTMITMAGIFHVPLYFQVLGDSATGAGLKMLPSPLGISIFSVGAGFVMKRTGR
YYWLGVSSVLVLIGGVIIFTLQGKYSPLWYSSVAFFFVGGGYGAMLTVTLLACVAAVDHSQQAVVTSATYLGRSV
GGTVGVTLGSAVYQNVLKARLWARFGGLPGAAEEIGRIRNDLSELKRLPPGWHDGVIDSFMEAFQSVWLVMLAIA
VAALVSISMMRQYTLHATLERR*
Coding >Ophcf2|06788
ATGGCTTCGAACGGCGCCCAGAATAGCCACGAGCGCTCTCCGCTCATACAGCCGGATGCCAGAGTCCATGTTCCG
CAACCCGTCCAAGGCAATGGTGACGACGACGACGATGAGCGCACCGTGGTGGCGAAGCAGCTCCCTTTTCCGAGG
CTGGCCTTCATAATGGGCACAGCCTGGTTGGGCGTCTTCCTCGGCGCCATCGATAGCACCGTCATCGCTACGCTA
TCGGCCTCCATCGCCAGCGAGTTCAAGTCGCTGAGTCTGCTGTCCTGGCTGGCGACCGCCTACCTCATCTCCACA
GCCGCCTGCCAGCCCATCTCGGGCCGGCTAACGGACATCTTCGGCCGTGGAACCGGTCTGATCTTCAGTAACCTC
TTCTTCGCTGCCGGCAATCTTATATGCGGACTAGCGCAGGACGACAGCACCATGATCTTGGGTCGCATTATCGCC
GGCATTGGTGGTGGGGGGCTCATGAGCATCTCGACCTTTCTCGGATCCGACTTGATTCCCCTCAGAAACCGAGGT
ATCGCCCAGGGCATCGGCAACATCTGCTACGGCTCCGGCGCCATGCTGGGCAGCGTCTTTGGTGGCCTGATGAAT
GATCGTACCAGTTGGGGCTGGAGGCTGGCCTTTCTGATTCAGGTGCCTCCCGTGCTCTTTTCCGCCGTCACTGCC
GCTATCCTCGTCAAAGTGCCTCCGAAACAATCCAAGAAATCGCTGTTAGCGCGCATCGACTTCGTCGGCGTCTTA
CTGACCACGTCCTTTCTCGTGATCCTACTCCTAGGGCTGAACTCGGGCGGAAACATTGTGCCGTGGACGCATCCG
CTACCGCTGGTGACGATTCCACTATCCTTCGTCATCTTCGCCGGCTTCCTTTGGTGGGAAAGCAGAGCTCGGCAG
CCTATTATCCCCATCAAGCTATTGATGGTTCGGACCGTCCTGGCCGCGTGCGTGTGCAACTTGCTATGCACCATG
ATCACAATGGCCGGCATCTTCCACGTGCCGCTCTACTTTCAAGTGCTGGGCGATTCGGCCACGGGGGCCGGGCTC
AAGATGCTTCCATCGCCGCTGGGCATCTCCATCTTCTCCGTTGGCGCCGGTTTCGTCATGAAGCGGACGGGCCGC
TACTACTGGCTCGGCGTGTCCAGCGTCCTCGTCCTCATCGGAGGTGTCATCATCTTTACTCTGCAGGGCAAATAT
TCCCCCTTGTGGTACAGCAGCGTCGCCTTCTTCTTCGTCGGAGGCGGATACGGTGCCATGTTGACTGTGACGCTG
CTGGCCTGCGTTGCGGCCGTCGATCATTCGCAACAGGCCGTCGTTACGTCGGCAACATATCTAGGTAGAAGCGTG
GGCGGCACCGTCGGCGTCACCCTGGGCTCGGCCGTCTACCAAAACGTCCTCAAGGCCCGGCTTTGGGCCAGGTTC
GGCGGCTTGCCCGGCGCTGCTGAGGAGATTGGCCGGATCCGCAACGACCTGAGCGAGTTGAAGCGACTCCCTCCC
GGCTGGCACGATGGCGTCATCGACTCCTTCATGGAGGCCTTTCAGAGCGTGTGGCTGGTGATGCTCGCTATTGCA
GTGGCGGCGCTGGTGAGCATCTCGATGATGCGACAGTACACGCTTCACGCGACGCTAGAGAGGCGTTGA
Transcript >Ophcf2|06788
ATGGCTTCGAACGGCGCCCAGAATAGCCACGAGCGCTCTCCGCTCATACAGCCGGATGCCAGAGTCCATGTTCCG
CAACCCGTCCAAGGCAATGGTGACGACGACGACGATGAGCGCACCGTGGTGGCGAAGCAGCTCCCTTTTCCGAGG
CTGGCCTTCATAATGGGCACAGCCTGGTTGGGCGTCTTCCTCGGCGCCATCGATAGCACCGTCATCGCTACGCTA
TCGGCCTCCATCGCCAGCGAGTTCAAGTCGCTGAGTCTGCTGTCCTGGCTGGCGACCGCCTACCTCATCTCCACA
GCCGCCTGCCAGCCCATCTCGGGCCGGCTAACGGACATCTTCGGCCGTGGAACCGGTCTGATCTTCAGTAACCTC
TTCTTCGCTGCCGGCAATCTTATATGCGGACTAGCGCAGGACGACAGCACCATGATCTTGGGTCGCATTATCGCC
GGCATTGGTGGTGGGGGGCTCATGAGCATCTCGACCTTTCTCGGATCCGACTTGATTCCCCTCAGAAACCGAGGT
ATCGCCCAGGGCATCGGCAACATCTGCTACGGCTCCGGCGCCATGCTGGGCAGCGTCTTTGGTGGCCTGATGAAT
GATCGTACCAGTTGGGGCTGGAGGCTGGCCTTTCTGATTCAGGTGCCTCCCGTGCTCTTTTCCGCCGTCACTGCC
GCTATCCTCGTCAAAGTGCCTCCGAAACAATCCAAGAAATCGCTGTTAGCGCGCATCGACTTCGTCGGCGTCTTA
CTGACCACGTCCTTTCTCGTGATCCTACTCCTAGGGCTGAACTCGGGCGGAAACATTGTGCCGTGGACGCATCCG
CTACCGCTGGTGACGATTCCACTATCCTTCGTCATCTTCGCCGGCTTCCTTTGGTGGGAAAGCAGAGCTCGGCAG
CCTATTATCCCCATCAAGCTATTGATGGTTCGGACCGTCCTGGCCGCGTGCGTGTGCAACTTGCTATGCACCATG
ATCACAATGGCCGGCATCTTCCACGTGCCGCTCTACTTTCAAGTGCTGGGCGATTCGGCCACGGGGGCCGGGCTC
AAGATGCTTCCATCGCCGCTGGGCATCTCCATCTTCTCCGTTGGCGCCGGTTTCGTCATGAAGCGGACGGGCCGC
TACTACTGGCTCGGCGTGTCCAGCGTCCTCGTCCTCATCGGAGGTGTCATCATCTTTACTCTGCAGGGCAAATAT
TCCCCCTTGTGGTACAGCAGCGTCGCCTTCTTCTTCGTCGGAGGCGGATACGGTGCCATGTTGACTGTGACGCTG
CTGGCCTGCGTTGCGGCCGTCGATCATTCGCAACAGGCCGTCGTTACGTCGGCAACATATCTAGGTAGAAGCGTG
GGCGGCACCGTCGGCGTCACCCTGGGCTCGGCCGTCTACCAAAACGTCCTCAAGGCCCGGCTTTGGGCCAGGTTC
GGCGGCTTGCCCGGCGCTGCTGAGGAGATTGGCCGGATCCGCAACGACCTGAGCGAGTTGAAGCGACTCCCTCCC
GGCTGGCACGATGGCGTCATCGACTCCTTCATGGAGGCCTTTCAGAGCGTGTGGCTGGTGATGCTCGCTATTGCA
GTGGCGGCGCTGGTGAGCATCTCGATGATGCGACAGTACACGCTTCACGCGACGCTAGAGAGGCGTTGA
Gene >Ophcf2|06788
ATGGCTTCGAACGGCGCCCAGAATAGCCACGAGCGCTCTCCGCTCATACAGCCGGATGCCAGAGTCCATGTTCCG
CAACCCGTCCAAGGCAATGGTGACGACGACGACGATGAGCGCACCGTGGTGGCGAAGCAGCTCCCTTTTCCGAGG
CTGGCCTTCATAATGGGCACAGCCTGGTTGGGCGTCTTCCTCGGCGCCATCGATAGCACCGTCATCGCTACGCTA
TCGGCCTCCATCGCCAGCGAGTTCAAGTCGCTGAGTCTGCTGTCCTGGCTGGCGACCGCCTACCTCATCTCCACA
GCCGCCTGCCAGCCCATCTCGGGCCGGCTAACGGACATCTTCGGCCGTGGAACCGGTCTGATCTTCAGTAACCTC
TTCTTCGCTGCCGGCAATCTTATATGCGGACTAGCGCAGGACGACAGCACCATGATCTTGGGTCGCATTATCGCC
GGCATTGGTGGTGGGGGGCTCATGAGCATCTCGACCTTTCTCGGATCCGACTTGATTCCCCTCAGAAACCGAGGT
ATCGCCCAGGGCATCGGCAACATCTGCTACGGCTCCGGCGCCATGCTGGGCAGCGTCTTTGGTGGCCTGATGAAT
GATCGTACCAGTTGGGGCTGGAGGCTGGCCTTTCTGATTCAGGTGCCTCCCGTGCTCTTTTCCGCCGTCACTGCC
GCTATCCTCGTCAAAGTGCCTCCGAAACAATCCAAGAAATCGCTGTTAGCGCGCATCGACTTCGTCGGCGTCTTA
CTGACCACGTCCTTTCTCGTGATCCTACTCCTAGGGCTGAACTCGGGCGGAAACATTGTGCCGTGGACGCATCCG
CTACCGCTGGTGACGATTCCACTATCCTTCGTCATCTTCGCCGGCTTCCTTTGGTGGGAAAGCAGAGCTCGGCAG
CCTATTATCCCCATCAAGCTATTGATGGTTCGGACCGTCCTGGCCGCGTGCGTGTGCAACTTGCTATGCACCATG
ATCACAATGGCCGGCATCTTCCACGTGCCGCTCTACTTTCAAGTGCTGGGCGATTCGGCCACGGGGGCCGGGCTC
AAGATGCTTCCATCGCCGCTGGGCATCTCCATCTTCTCCGTTGGCGCCGGTTTCGTCATGAAGCGGACGGGCCGC
TACTACTGGCTCGGCGTGTCCAGCGTCCTCGTCCTCATCGGAGGTGTCATCATCTTTACTCTGCAGGGCAAATAT
TCCCCCTTGTGGTACAGCAGCGTCGCCTTCTTCTTCGTCGGAGGCGGATACGGTGCCATGTTGACTGTGACGCTG
CTGGCCTGCGTTGCGGCCGTCGATCATTCGCAACAGGCCGTCGTTACGTCGGCAACATGTAAGCGTCTCCCTCTG
GTGCTCAATCCTGCAATCCTACCCGCCTGCCTGCCTGCCTGCATCTGACCAAGTACCTGAAGATCTAGGTAGAAG
CGTGGGCGGCACCGTCGGCGTCACCCTGGGCTCGGCCGTCTACCAAAACGTCCTCAAGGCCCGGCTTTGGGCCAG
GTTCGGCGGCTTGCCCGGCGCTGCTGAGGAGATTGGCCGGATCCGCAACGACCTGAGCGAGTTGAAGCGACTCCC
TCCCGGCTGGCACGATGGCGTCATCGACTCCTTCATGGAGGCCTTTCAGAGCGTGTGGCTGGTGATGCTCGCTAT
TGCAGTGGCGGCGCTGGTGAGCATCTCGATGATGCGACAGTACACGCTTCACGCGACGCTAGAGAGGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail