Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06787
Gene name
Locationscaffold_08:1064139..1065043
Strand-
Gene length (bp)904
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 44 66 22
3 81 98 17
4 119 141 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 90.60 50.31 130.89
Alive In ants, during behavior modification 69.63 37.08 102.18
Dead In ants, recently dead 64.41 34.00 94.81

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.210123 no
Alive Dead 0.713322 no
Dead Fungus 0.087745 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06787
MVDLEWDPDNVPRTKLVLHTLQMLLVFTIWCLEIAVFVGKGAKIVADNAFTFTMCFVSIPAWLYLLMAPRFDRGR
RFAEPRAMLVIDVLFTILWLAAFATQAAYNTANLCGQRCNLSKGIVGLGIFTTLLFAATSLISAYTLKYYNFHGT
LPGYESRKALNANGSSSAIDPDKAAFSTADEDYERVNLDDREAAGANDYSDSGRYAPANPYSADDFADPSRYSPL
PPRNNDLFNTDTEYSSGGAAHKPYADEPARFPAGNYDRAHP*
Coding >Ophcf2|06787
ATGGTCGACTTAGAGTGGGATCCTGACAATGTCCCGCGGACGAAGCTCGTGCTACACACCCTACAGATGCTGCTC
GTCTTCACCATCTGGTGTTTGGAAATCGCCGTCTTCGTGGGCAAGGGCGCCAAGATCGTCGCCGACAATGCCTTT
ACATTCACCATGTGCTTCGTCTCCATTCCTGCGTGGCTCTATCTCTTGATGGCACCTCGGTTCGATCGTGGCCGC
CGCTTCGCCGAACCGCGCGCTATGCTCGTCATCGACGTCCTCTTCACCATCCTTTGGCTGGCGGCCTTTGCCACC
CAGGCCGCTTATAACACGGCCAACCTCTGCGGCCAGCGCTGCAACTTGAGCAAGGGTATCGTCGGGCTGGGCATC
TTCACAACACTACTCTTCGCCGCTACTTCGCTCATCAGCGCCTACACGCTCAAGTACTACAACTTCCACGGCACA
CTTCCAGGCTACGAGTCTCGCAAGGCGCTCAACGCCAACGGCAGCTCCAGCGCCATCGACCCCGACAAGGCCGCC
TTCTCCACGGCCGACGAGGACTACGAGCGGGTCAACCTCGACGACCGCGAGGCCGCCGGCGCCAACGACTACTCC
GACTCGGGCCGTTACGCCCCGGCGAACCCCTACAGCGCCGATGACTTTGCCGATCCCAGCCGTTACAGCCCGCTG
CCGCCTCGCAACAACGACCTCTTTAATACCGATACCGAGTACAGCTCGGGCGGCGCGGCGCACAAGCCGTACGCG
GATGAGCCCGCGCGTTTTCCTGCCGGCAACTACGATCGGGCGCATCCGTAG
Transcript >Ophcf2|06787
ATGGTCGACTTAGAGTGGGATCCTGACAATGTCCCGCGGACGAAGCTCGTGCTACACACCCTACAGATGCTGCTC
GTCTTCACCATCTGGTGTTTGGAAATCGCCGTCTTCGTGGGCAAGGGCGCCAAGATCGTCGCCGACAATGCCTTT
ACATTCACCATGTGCTTCGTCTCCATTCCTGCGTGGCTCTATCTCTTGATGGCACCTCGGTTCGATCGTGGCCGC
CGCTTCGCCGAACCGCGCGCTATGCTCGTCATCGACGTCCTCTTCACCATCCTTTGGCTGGCGGCCTTTGCCACC
CAGGCCGCTTATAACACGGCCAACCTCTGCGGCCAGCGCTGCAACTTGAGCAAGGGTATCGTCGGGCTGGGCATC
TTCACAACACTACTCTTCGCCGCTACTTCGCTCATCAGCGCCTACACGCTCAAGTACTACAACTTCCACGGCACA
CTTCCAGGCTACGAGTCTCGCAAGGCGCTCAACGCCAACGGCAGCTCCAGCGCCATCGACCCCGACAAGGCCGCC
TTCTCCACGGCCGACGAGGACTACGAGCGGGTCAACCTCGACGACCGCGAGGCCGCCGGCGCCAACGACTACTCC
GACTCGGGCCGTTACGCCCCGGCGAACCCCTACAGCGCCGATGACTTTGCCGATCCCAGCCGTTACAGCCCGCTG
CCGCCTCGCAACAACGACCTCTTTAATACCGATACCGAGTACAGCTCGGGCGGCGCGGCGCACAAGCCGTACGCG
GATGAGCCCGCGCGTTTTCCTGCCGGCAACTACGATCGGGCGCATCCGTAG
Gene >Ophcf2|06787
ATGGTCGACTTAGAGTGGGATCCTGACAATGTCCCGCGGACGAAGCTCGTGCTACACACCCTACAGATGCTGCTC
GTCTTCACCATCTGGTGTTTGGAAATCGCCGTCTTCGTGGGCAAGGGCGCCAAGATCGTCGCCGACAATGCCTTT
ACATTCACCATGGTTCGTCTTGTCTGGGCTCCCTCAAGCTCCCCGTGACTGACGCTCCGGCGCAGTGCTTCGTCT
CCATTCCTGCGTGGCTCTATCTCTTGATGGCACCTCGGTTCGATCGTGGCCGCCGCTTCGCCGAACCGCGCGCTA
TGCTCGTCATCGACGTCCTCTTCACCATCCTTTGGCTGGCGGCCTTTGCCACCCAGGCCGCTTATAACACGGCCA
ACCTCTGCGGCCAGCGCTGCAACTTGAGCAAGGGTATCGTCGGGCTGGGCATCTTCACAACGTGCGTACATAATG
CCAATGTCCCTGACGAAATCTAATCTTTCCATTTAGACTACTCTTCGCCGCTACTTCGCTCATCAGCGCCTACAC
GCTCAAGTACTACAACTTCCACGGCACACTTCCAGGCTACGAGTCTCGCAAGGCGCTCAACGCCAACGGCAGCTC
CAGCGCCATCGACCCCGACAAGGCCGCCTTCTCCACGGCCGACGAGGACTACGAGCGGGTCAACCTCGACGACCG
CGAGGCCGCCGGCGCCAACGACTACTCCGACTCGGGCCGTTACGCCCCGGCGAACCCCTACAGCGCCGATGACTT
TGCCGATCCCAGCCGTTACAGCCCGCTGCCGCCTCGCAACAACGACCTCTTTAATACCGATACCGAGTACAGCTC
GGGCGGCGCGGCGCACAAGCCGTACGCGGATGAGCCCGCGCGTTTTCCTGCCGGCAACTACGATCGGGCGCATCC
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail