Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06779
Gene name
Locationscaffold_08:1044414..1045634
Strand+
Gene length (bp)1220
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13230 GATase_4 Glutamine amidotransferases class-II 2.2E-13 38 186
PF13522 GATase_6 Glutamine amidotransferase domain 7.4E-07 85 166

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5096 0.6142 0.0784 0.0664 0.2478 0.0065 0.1177 0.2821 0.3086 0.1976

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1570
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2279
Ophiocordyceps australis map64 (Brazil) OphauB2|5993
Ophiocordyceps camponoti-floridani Ophcf2|06779 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5908
Ophiocordyceps kimflemingae Ophio5|2619
Ophiocordyceps subramaniannii Hirsu2|1163

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06779
MCRFLVYKGSDEILLSKLILDPVHSILKQSFDSRLRLDTRRGQNNADGFGIGFYTDPKLGAPPCLFTSTIPAWNC
TNLQRIASKTASRLIFGHVRATTEGSLSEDNCHPFTHGSLMWMHNGNLGGWKHIKRRLGQRLADKWYLGVKGGTD
SEWAFALFLDTLERLGHDPSACPETGFGPTVLREAMEQTIAQINQLTDSIPQDVVEADDVDTRSLLNLALTDGHS
VICTRYVSSSKDEAASLYYSSGTQWATRTTDPDDRHYQMERRDKGADIVLVASEPLTFERENWVNVPTNSVLTIH
RQTVMMHPILDRHYERDPCHVRSSAFVQAKGLVSNEKAPSPAHEPPPVRL*
Coding >Ophcf2|06779
ATGTGCCGGTTTCTAGTCTACAAGGGCAGCGACGAGATTCTCTTGTCCAAGCTGATACTCGACCCCGTCCATTCC
ATCCTCAAGCAATCATTCGACTCGAGGCTGCGGCTCGACACGCGACGTGGCCAGAACAACGCAGATGGCTTCGGC
ATCGGCTTCTACACCGACCCCAAACTCGGCGCCCCTCCCTGTCTCTTCACCTCGACGATTCCGGCTTGGAACTGC
ACGAACCTGCAGCGCATCGCATCCAAGACAGCCTCGCGCCTCATCTTCGGCCACGTCCGCGCCACCACAGAGGGA
TCCCTGAGCGAGGACAACTGTCACCCTTTCACCCACGGCAGCCTCATGTGGATGCACAACGGAAACCTCGGCGGC
TGGAAGCACATCAAGCGCCGCCTCGGCCAACGCCTCGCCGATAAGTGGTATCTCGGCGTCAAGGGCGGCACCGAC
AGCGAATGGGCCTTTGCCCTCTTCCTCGACACCCTCGAGCGTCTCGGCCACGATCCGAGCGCCTGTCCGGAAACG
GGCTTCGGCCCGACGGTGCTGCGAGAAGCCATGGAGCAGACCATTGCCCAGATCAACCAACTCACAGACTCGATT
CCGCAGGACGTGGTAGAGGCCGACGACGTCGACACCCGGAGCCTGCTCAACCTGGCCCTCACCGACGGCCACAGC
GTCATCTGCACCCGCTACGTCAGCAGCTCCAAGGACGAGGCCGCCAGTCTCTACTACTCGTCCGGCACGCAGTGG
GCCACTCGGACGACGGACCCGGACGACCGCCACTATCAGATGGAGAGGAGGGACAAGGGCGCCGACATCGTCCTC
GTTGCCAGCGAACCGCTGACGTTTGAAAGGGAGAACTGGGTCAACGTGCCGACAAACTCGGTCCTGACCATCCAC
CGACAGACAGTCATGATGCATCCCATTCTCGACCGGCACTACGAGCGAGATCCGTGTCACGTCCGCTCTAGCGCC
TTTGTCCAGGCCAAGGGACTCGTATCCAACGAGAAAGCGCCAAGCCCGGCACATGAACCGCCGCCTGTTCGGCTC
TGA
Transcript >Ophcf2|06779
ATGTGCCGGTTTCTAGTCTACAAGGGCAGCGACGAGATTCTCTTGTCCAAGCTGATACTCGACCCCGTCCATTCC
ATCCTCAAGCAATCATTCGACTCGAGGCTGCGGCTCGACACGCGACGTGGCCAGAACAACGCAGATGGCTTCGGC
ATCGGCTTCTACACCGACCCCAAACTCGGCGCCCCTCCCTGTCTCTTCACCTCGACGATTCCGGCTTGGAACTGC
ACGAACCTGCAGCGCATCGCATCCAAGACAGCCTCGCGCCTCATCTTCGGCCACGTCCGCGCCACCACAGAGGGA
TCCCTGAGCGAGGACAACTGTCACCCTTTCACCCACGGCAGCCTCATGTGGATGCACAACGGAAACCTCGGCGGC
TGGAAGCACATCAAGCGCCGCCTCGGCCAACGCCTCGCCGATAAGTGGTATCTCGGCGTCAAGGGCGGCACCGAC
AGCGAATGGGCCTTTGCCCTCTTCCTCGACACCCTCGAGCGTCTCGGCCACGATCCGAGCGCCTGTCCGGAAACG
GGCTTCGGCCCGACGGTGCTGCGAGAAGCCATGGAGCAGACCATTGCCCAGATCAACCAACTCACAGACTCGATT
CCGCAGGACGTGGTAGAGGCCGACGACGTCGACACCCGGAGCCTGCTCAACCTGGCCCTCACCGACGGCCACAGC
GTCATCTGCACCCGCTACGTCAGCAGCTCCAAGGACGAGGCCGCCAGTCTCTACTACTCGTCCGGCACGCAGTGG
GCCACTCGGACGACGGACCCGGACGACCGCCACTATCAGATGGAGAGGAGGGACAAGGGCGCCGACATCGTCCTC
GTTGCCAGCGAACCGCTGACGTTTGAAAGGGAGAACTGGGTCAACGTGCCGACAAACTCGGTCCTGACCATCCAC
CGACAGACAGTCATGATGCATCCCATTCTCGACCGGCACTACGAGCGAGATCCGTGTCACGTCCGCTCTAGCGCC
TTTGTCCAGGCCAAGGGACTCGTATCCAACGAGAAAGCGCCAAGCCCGGCACATGAACCGCCGCCTGTTCGGCTC
TGA
Gene >Ophcf2|06779
ATGTGCCGGTTTCTAGTTTGTCGTCTCTCCACCCCTGCCGCTGATGACGCTCACCTACTCTCGGCCAGGTCTACA
AGGGCAGCGACGAGATTCTCTTGTCCAAGCTGATACTCGACCCCGTCCATTCCATCCTCAAGCAATCATTCGACT
CGAGGCTGCGGCTCGTCAGTGATATATCTATCCTCTAAACCCGAGAGAACCTCATCGCTGACAATGCAAAAGGAC
ACGCGACGTGGCCAGAACAACGCAGATGGCTTCGGCATCGGCTTCTACACCGACCCCAAACTCGGCGCCCCTCCC
TGTCTCTTCACCTCGACGATTCCGGCTTGGAACTGCACGAACCTGCAGCGCATCGCATCCAAGACAGCCTCGCGC
CTCATCTTCGGCCACGTCCGCGCCACCACAGAGGGATCCCTGAGCGAGGACAACTGTCACCCTTTCACCCACGGC
AGCCTCATGTGGATGCACAACGGAAACCTCGGCGGCTGGAAGCACATCAAGCGCCGCCTCGGCCAACGCCTCGCC
GATAAGTGGTATCTCGGCGTCAAGGGCGGCACCGACAGCGAATGGGCCTTTGCCCTCTTCCTCGACACCCTCGAG
CGTCTCGGCCACGATCCGAGCGCCTGTCCGGAAACGGGCTTCGGCCCGACGGTGCTGCGAGAAGCCATGGAGCAG
ACCATTGCCCAGATCAACCAACTCACAGACTCGATTCCGCAGGACGTGGTAGAGGCCGACGACGTCGACACCCGG
AGCCTGCTCAACCTGGCCCTCACCGACGGCCACAGCGTCATCTGCACCCGCTACGTCAGCAGCTCCAAGGACGAG
GCCGCCAGTCTCTACTACTCGTCCGGCACGCAGTGGGCCACTCGGACGACGGACCCGGACGACCGCCACTATCAG
ATGGAGAGGAGGGACAAGGGCGCCGACATCGTCCTCGTTGCCAGCGAACCGCTGACGTTTGAAAGGGGTGAGCTC
CCGCCTACTCTTTACAGCTCTATCTTTTTCGTGGCTGATGAGCATCAGAGAACTGGGTCAACGTGCCGACAAACT
CGGTCCTGACCATCCACCGACAGACAGTCATGATGCATCCCATTCTCGACCGGCACTACGAGCGAGATCCGTGTC
ACGTCCGCTCTAGCGCCTTTGTCCAGGCCAAGGGACTCGTATCCAACGAGAAAGCGCCAAGCCCGGCACATGAAC
CGCCGCCTGTTCGGCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail