Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06778
Gene name
Locationscaffold_08:1041642..1043641
Strand-
Gene length (bp)1999
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 2.4E-04 561 591

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.214 0.9249 0.0356 0.0106 0.063 0.0033 0.0296 0.0163 0.0098 0.0099

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2280
Ophiocordyceps australis map64 (Brazil) OphauB2|5992
Ophiocordyceps camponoti-floridani Ophcf2|06778 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5909
Ophiocordyceps kimflemingae Ophio5|2620
Ophiocordyceps subramaniannii Hirsu2|1164

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06778
MEPPSSPTERLQAVEEASRKKRWVQSPGPRTKRRRTTLSDDESQSVTHENVSIERRTLSQFFKASRKGTLGSGGK
SLESSRPLLAAKAEVTTTLQDYQPQPIRKLRNRGFEARLLDREHGFSVQAGKQYLAFPAADARIETAAFHSDSSD
AYHCTPLGDQVGTSIPFSLASCHHVPVTAIGDERGDVRFLSTAEGAGEQVQSWVKVHDNAIMDLAFSADDSRLAS
ACGDRSGHVLDTQTQTVAVKLSDHWDSLRQVTFQPGGGNGNVLASSDRAGRVQVWDLRCSSLPAQCFSSATEGVV
RDRGLAVAAARTVNTMDGAHERTTHGNTSSSSVTALQWLPAGREHLLLTGSEANASVKLWDTRYIKPRRQRQAAE
RPVASTPEPATHAWRSYGITSMTLGSDAARLYVVCKDSTVYAYSTSHLVLGHAPELADGAGKRRPTGSRGLGPLY
GLRNDALRVGSFYVKCAVRRSGLGGGMDELLAVGSSDGCAVLFPTDERYLRTAWARREHVTTTTTTTTTTTTTTT
TAMAPPPPTTPSSTSFSNPPSPSTTLPLIRTGTALIRGHSHEVTTLSWSSQGKLVTASDDCLVRQWQPNADRARH
LRHVGEFGGERHLAGWADVGDQWDVDEW*
Coding >Ophcf2|06778
ATGGAACCTCCCTCATCGCCGACGGAACGACTCCAGGCCGTGGAAGAGGCCTCGAGGAAGAAACGTTGGGTCCAA
TCTCCCGGGCCGCGGACGAAGCGACGTCGGACAACGCTGTCAGACGACGAGTCCCAGTCAGTGACTCACGAGAAT
GTCTCCATCGAGAGGCGTACTCTTAGCCAGTTCTTCAAGGCTAGTCGCAAAGGAACCCTTGGCTCGGGAGGCAAA
TCTCTAGAGTCCAGTCGGCCATTGCTCGCTGCCAAGGCTGAAGTGACGACGACGCTCCAAGATTACCAGCCGCAG
CCCATTCGAAAGCTGCGAAACCGCGGCTTCGAAGCCCGTCTTCTCGACCGCGAGCACGGCTTCAGCGTCCAAGCC
GGAAAGCAGTACCTGGCCTTTCCCGCCGCCGACGCCAGGATAGAGACGGCCGCTTTCCACAGCGACAGCTCCGAC
GCCTACCACTGCACGCCATTGGGCGACCAGGTCGGCACGTCCATCCCCTTTAGCCTCGCCAGCTGTCACCACGTC
CCGGTGACGGCCATCGGCGACGAAAGGGGCGATGTGCGCTTCCTATCAACGGCAGAAGGCGCGGGTGAACAGGTA
CAGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGACCTCGCCTTCTCGGCCGACGACTCGCGGCTGGCCAGC
GCATGCGGTGACAGATCCGGGCACGTGCTAGACACGCAGACGCAGACGGTGGCCGTCAAGCTGAGCGACCACTGG
GACTCGTTGCGACAGGTCACCTTTCAGCCGGGCGGCGGCAACGGCAACGTGCTCGCGTCGTCGGACCGGGCCGGC
CGGGTTCAAGTCTGGGACCTCCGATGCTCCTCCCTTCCGGCTCAATGCTTCTCATCGGCGACCGAAGGCGTGGTC
CGGGACCGGGGACTGGCGGTGGCGGCGGCCCGGACGGTCAACACCATGGACGGCGCTCACGAACGGACGACACAC
GGCAACACGTCGTCTTCGTCGGTCACGGCGCTGCAGTGGCTACCGGCCGGGCGCGAGCACCTCCTACTGACGGGA
TCCGAGGCCAACGCATCGGTCAAGCTATGGGACACGCGCTACATCAAGCCGCGACGACAGCGACAGGCAGCGGAG
CGACCGGTAGCGTCAACGCCGGAGCCCGCGACCCACGCGTGGCGCTCGTACGGCATCACGTCCATGACGCTCGGA
TCCGACGCCGCGCGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTATTCAACCAGCCACCTCGTCCTC
GGCCACGCGCCCGAACTGGCGGACGGAGCCGGCAAGCGCAGGCCGACGGGGTCCCGGGGTCTCGGCCCGCTGTAC
GGGCTCCGGAACGACGCGCTACGGGTCGGGTCCTTTTACGTCAAGTGCGCTGTGCGTCGGTCGGGTCTCGGTGGC
GGCATGGACGAGCTCTTGGCCGTGGGGAGCTCCGATGGCTGTGCGGTGCTGTTTCCTACGGACGAGCGTTACCTC
CGGACGGCGTGGGCTCGTCGCGAACACGTGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACG
ACGGCCATGGCTCCTCCACCACCGACGACACCATCATCAACCTCATTTTCGAACCCTCCGTCTCCGTCGACGACA
CTTCCTCTAATCCGCACGGGAACGGCACTCATCCGCGGCCACAGCCACGAGGTGACGACACTGAGCTGGTCGTCA
CAAGGGAAGCTCGTGACCGCTTCGGACGACTGCCTCGTCCGGCAGTGGCAGCCCAACGCAGACCGGGCGCGTCAT
CTCCGGCACGTGGGCGAGTTTGGCGGCGAGAGGCACCTTGCAGGATGGGCCGACGTCGGGGACCAGTGGGATGTG
GATGAGTGGTGA
Transcript >Ophcf2|06778
ATGGAACCTCCCTCATCGCCGACGGAACGACTCCAGGCCGTGGAAGAGGCCTCGAGGAAGAAACGTTGGGTCCAA
TCTCCCGGGCCGCGGACGAAGCGACGTCGGACAACGCTGTCAGACGACGAGTCCCAGTCAGTGACTCACGAGAAT
GTCTCCATCGAGAGGCGTACTCTTAGCCAGTTCTTCAAGGCTAGTCGCAAAGGAACCCTTGGCTCGGGAGGCAAA
TCTCTAGAGTCCAGTCGGCCATTGCTCGCTGCCAAGGCTGAAGTGACGACGACGCTCCAAGATTACCAGCCGCAG
CCCATTCGAAAGCTGCGAAACCGCGGCTTCGAAGCCCGTCTTCTCGACCGCGAGCACGGCTTCAGCGTCCAAGCC
GGAAAGCAGTACCTGGCCTTTCCCGCCGCCGACGCCAGGATAGAGACGGCCGCTTTCCACAGCGACAGCTCCGAC
GCCTACCACTGCACGCCATTGGGCGACCAGGTCGGCACGTCCATCCCCTTTAGCCTCGCCAGCTGTCACCACGTC
CCGGTGACGGCCATCGGCGACGAAAGGGGCGATGTGCGCTTCCTATCAACGGCAGAAGGCGCGGGTGAACAGGTA
CAGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGACCTCGCCTTCTCGGCCGACGACTCGCGGCTGGCCAGC
GCATGCGGTGACAGATCCGGGCACGTGCTAGACACGCAGACGCAGACGGTGGCCGTCAAGCTGAGCGACCACTGG
GACTCGTTGCGACAGGTCACCTTTCAGCCGGGCGGCGGCAACGGCAACGTGCTCGCGTCGTCGGACCGGGCCGGC
CGGGTTCAAGTCTGGGACCTCCGATGCTCCTCCCTTCCGGCTCAATGCTTCTCATCGGCGACCGAAGGCGTGGTC
CGGGACCGGGGACTGGCGGTGGCGGCGGCCCGGACGGTCAACACCATGGACGGCGCTCACGAACGGACGACACAC
GGCAACACGTCGTCTTCGTCGGTCACGGCGCTGCAGTGGCTACCGGCCGGGCGCGAGCACCTCCTACTGACGGGA
TCCGAGGCCAACGCATCGGTCAAGCTATGGGACACGCGCTACATCAAGCCGCGACGACAGCGACAGGCAGCGGAG
CGACCGGTAGCGTCAACGCCGGAGCCCGCGACCCACGCGTGGCGCTCGTACGGCATCACGTCCATGACGCTCGGA
TCCGACGCCGCGCGGCTCTACGTCGTCTGCAAGGACAGCACCGTCTACGCCTATTCAACCAGCCACCTCGTCCTC
GGCCACGCGCCCGAACTGGCGGACGGAGCCGGCAAGCGCAGGCCGACGGGGTCCCGGGGTCTCGGCCCGCTGTAC
GGGCTCCGGAACGACGCGCTACGGGTCGGGTCCTTTTACGTCAAGTGCGCTGTGCGTCGGTCGGGTCTCGGTGGC
GGCATGGACGAGCTCTTGGCCGTGGGGAGCTCCGATGGCTGTGCGGTGCTGTTTCCTACGGACGAGCGTTACCTC
CGGACGGCGTGGGCTCGTCGCGAACACGTGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACG
ACGGCCATGGCTCCTCCACCACCGACGACACCATCATCAACCTCATTTTCGAACCCTCCGTCTCCGTCGACGACA
CTTCCTCTAATCCGCACGGGAACGGCACTCATCCGCGGCCACAGCCACGAGGTGACGACACTGAGCTGGTCGTCA
CAAGGGAAGCTCGTGACCGCTTCGGACGACTGCCTCGTCCGGCAGTGGCAGCCCAACGCAGACCGGGCGCGTCAT
CTCCGGCACGTGGGCGAGTTTGGCGGCGAGAGGCACCTTGCAGGATGGGCCGACGTCGGGGACCAGTGGGATGTG
GATGAGTGGTGA
Gene >Ophcf2|06778
ATGGAACCTCCCTCATCGCCGACGGAACGACTCCAGGCCGTGGAAGAGGCCTCGAGGAAGAAACGTTGGGTCCAA
TCTCCCGGGCCGCGGACGAAGCGACGTCGGACAACGCTGTCAGACGACGAGTCCCAGTCAGTGACTCACGAGAAT
GTCTCCATCGAGAGGCGTACTCTTGTGAGCGGCAGCCAAACCGACCACCCTTGGTCTCGTTACTTACCGTTTCAG
AGCCAGTTCTTCAAGGCTAGTCGCAAAGGAACCCTTGGCTCGGGAGGCAAATCTCTAGAGTCCAGTCGGCCATTG
CTCGCTGCCAAGGCTGAAGTGACGACGGTAAGCGGATGACAGTCAACTGCTCTCTTCATCTCGTTCAAGTTTGAC
TCTTACCTCGCAGACGCTCCAAGATTACCAGCCGCAGCCCATTCGAAAGCTGCGAAACCGCGGCTTCGAAGCCCG
TCTTCTCGACCGCGAGCACGGCTTCAGCGTCCAAGCCGGAAAGCAGTACCTGGCCTTTCCCGCCGCCGACGCCAG
GATAGAGACGGCCGCTTTCCACAGCGACAGCTCCGACGCCTACCACTGCACGCCATTGGGCGACCAGGTCGGCAC
GTCCATCCCCTTTAGCCTCGCCAGCTGTCACCACGTCCCGGTGACGGCCATCGGCGACGAAAGGGGCGATGTGCG
CTTCCTATCAACGGCAGAAGGCGCGGGTGAACAGGTACAGAGCTGGGTCAAGGTGCACGACAACGCCATCATGGA
CCTCGCCTTCTCGGCCGACGACTCGCGGCTGGCCAGCGCATGCGGTGACAGATCCGGGCACGTGCTAGACACGCA
GACGCAGACGGTGGCCGTCAAGCTGAGCGACCACTGGGACTCGTTGCGACAGGTCACCTTTCAGCCGGGCGGCGG
CAACGGCAACGTGCTCGCGTCGTCGGACCGGGCCGGCCGGGTTCAAGTCTGGGACCTCCGATGCTCCTCCCTTCC
GGCTCAATGCTTCTCATCGGCGACCGAAGGCGTGGTCCGGGACCGGGGACTGGCGGTGGCGGCGGCCCGGACGGT
CAACACCATGGACGGCGCTCACGAACGGACGACACACGGCAACACGTCGTCTTCGTCGGTCACGGCGCTGCAGTG
GCTACCGGCCGGGCGCGAGCACCTCCTACTGACGGGATCCGAGGCCAACGCATCGGTCAAGCTATGGGACACGCG
CTACATCAAGCCGCGACGACAGCGACAGGCAGCGGAGCGACCGGTAGCGTCAACGCCGGAGCCCGCGACCCACGC
GTGGCGCTCGTACGGCATCACGTCCATGACGCTCGGATCCGACGCCGCGCGGCTCTACGTCGTCTGCAAGGACAG
CACCGTCTACGCCTATTCAACCAGCCACCTCGTCCTCGGCCACGCGCCCGAACTGGCGGACGGAGCCGGCAAGCG
CAGGCCGACGGGGTCCCGGGGTCTCGGCCCGCTGTACGGGCTCCGGAACGACGCGCTACGGGTCGGGTCCTTTTA
CGTCAAGTGCGCTGTGCGTCGGTCGGGTCTCGGTGGCGGCATGGACGAGCTCTTGGCCGTGGGGAGCTCCGATGG
CTGTGCGGTGCTGTTTCCTACGGACGAGCGTTACCTCCGGACGGCGTGGGCTCGTCGCGAACACGTGACGACGAC
GACGACGACGACGACGACGACGACGACGACGACGACGACGGCCATGGCTCCTCCACCACCGACGACACCATCATC
AACCTCATTTTCGAACCCTCCGTCTCCGTCGACGACACTTCCTCTAATCCGCACGGGAACGGCACTCATCCGCGG
CCACAGCCACGAGGTGACGACACTGAGCTGGTCGTCACAAGGGAAGCTCGTGACCGCTTCGGACGACTGCCTCGT
CCGGCAGTGGCAGCCCAACGCAGACCGGGCGCGTCATCTCCGGCACGTGGGCGAGTTTGGCGGCGAGAGGCACCT
TGCAGGATGGGCCGACGTCGGGGACCAGTGGGATGTGGATGAGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail