Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06772
Gene name
Locationscaffold_08:1023598..1027253
Strand+
Gene length (bp)3655
Transcript length (bp)2400
Coding sequence length (bp)2400
Protein length (aa) 800

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-33 74 461

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 119 17
3 126 148 22
4 163 182 19
5 189 211 22
6 221 240 19
7 253 270 17
8 280 302 22
9 323 342 19
10 357 379 22
11 384 406 22
12 411 433 22
13 446 468 22
14 488 507 19
15 562 584 22
16 599 621 22
17 677 699 22
18 730 752 22
19 765 787 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06772
MDRIRNEKKQANIQSSGQGIETEAVAEADADVEGWCTTTTSDFDFKRLGWQRPAEFKDAWVEACFVLSSVGALAM
ADFIVDGFQVLLPALIDPLSIPPGAQIWPSSVVTMVAGSFLFPLGRLTDMYGGYLVFNGGLMWFTLWTLAAGFAT
DFIFLVFCRAMQGLGMAAFLPAGIALLGRFYRPGPRKNVVFALYGAACPVGFFGGVLTAGFSQEVLGQWRSFFWV
GGLVTGVCCVGTVLYSPRDEGHGVPMDWPGTLTTVPAIMLLLYAAAKGTGSDMGFMTPDVVVALVMGVVFLGLAV
VVETRVESPLIPVEIFRIKDMKAMLLYLLLSWGVYSMYQFYTSFYMQMVLNLSSLTTALWYAPWAVGGLLLSTLG
GLVLDRIPASWLLIPSSISAIMAVLLFAIMPTEPSYWLWIFPAMIFEAASADILWTVSNVFLTTSLPRHHQGLAG
AIISLTLFVGDAFFLAVGDVVEESMARAGKGARTQYKAVFWVAVVIGLAAMGINFIIRIPEASAELTVDERDELG
WEDWKRNMVDARIEQAFAAGRVPSNITREYLSRNRDGEGISGIVVITLLVSAVVVSRLLTRALVVKRLGLDDGLA
LASLLLFIPFAITCTQMILYGSGRPFIFRKLILPDEQFDVTQSLDTISQLLYATAMILGRASGLAFYHRICALYN
EFLIIIKFILCIIFLGYLAQMSLIILHCLPLTTLWEPSPREKYKCMQWIDVQGVNSAVSLLSDLLVFGVPLAMLR
VLKSMDRKRKVQLSCIFFPGLVVVFISIARIALAIIWNCKSSFPYPPIR*
Coding >Ophcf2|06772
ATGGACCGCATACGCAATGAGAAGAAGCAGGCCAACATACAGTCATCCGGACAGGGCATCGAGACGGAAGCAGTT
GCCGAGGCAGACGCCGATGTCGAAGGCTGGTGTACGACCACCACGTCCGACTTTGACTTCAAGAGGCTTGGTTGG
CAGCGGCCGGCCGAGTTTAAGGATGCTTGGGTTGAGGCTTGCTTTGTGCTCTCTTCGGTAGGGGCCTTGGCCATG
GCTGACTTCATCGTCGACGGCTTTCAAGTCTTGCTTCCCGCCCTCATCGACCCTCTTTCCATCCCGCCCGGGGCG
CAAATCTGGCCTTCGAGTGTCGTCACCATGGTGGCCGGCTCGTTTCTCTTCCCTCTGGGAAGGCTGACGGACATG
TACGGCGGTTACCTCGTCTTCAACGGAGGGTTGATGTGGTTCACGCTGTGGACGCTGGCCGCGGGATTCGCCACC
GATTTCATATTCCTCGTCTTTTGCAGGGCCATGCAGGGCTTGGGTATGGCTGCCTTCTTGCCTGCCGGGATTGCT
CTCCTCGGCCGCTTCTACAGACCCGGTCCTCGGAAGAACGTCGTGTTTGCGCTCTACGGTGCCGCCTGTCCGGTC
GGCTTCTTCGGAGGCGTCTTGACGGCGGGGTTCTCGCAAGAGGTCTTGGGGCAGTGGCGGTCTTTCTTCTGGGTT
GGGGGGTTGGTTACGGGTGTTTGCTGTGTTGGGACTGTGCTTTACAGTCCGAGGGATGAGGGTCATGGGGTTCCT
ATGGATTGGCCCGGGACGCTGACGACTGTTCCGGCCATCATGCTGTTGCTCTACGCTGCGGCCAAGGGGACGGGG
TCCGACATGGGGTTCATGACGCCCGATGTTGTTGTCGCTTTGGTCATGGGGGTTGTTTTCTTGGGGTTGGCTGTC
GTGGTCGAGACGAGGGTTGAGTCTCCGTTGATACCGGTTGAAATCTTCAGGATCAAGGATATGAAGGCTATGCTG
TTGTATCTGCTGCTGTCATGGGGTGTTTACTCCATGTATCAGTTTTACACCAGCTTCTACATGCAGATGGTGCTG
AACCTGTCGTCCCTGACGACGGCTCTCTGGTACGCCCCCTGGGCTGTTGGCGGTCTTCTCCTTTCGACGCTGGGT
GGTCTCGTCCTCGATAGGATCCCAGCGTCTTGGCTGCTCATCCCGTCGAGCATCTCGGCCATAATGGCCGTTCTT
CTCTTCGCCATCATGCCGACCGAACCGAGCTACTGGCTCTGGATCTTCCCGGCCATGATCTTCGAGGCGGCATCG
GCCGATATTCTATGGACGGTGAGCAACGTCTTCCTAACCACCAGCCTCCCCCGACACCATCAGGGCCTCGCCGGC
GCCATCATCAGCCTGACTCTCTTCGTGGGCGACGCCTTCTTCCTGGCCGTAGGCGACGTCGTCGAGGAGTCGATG
GCCAGAGCCGGGAAGGGGGCTCGGACGCAGTACAAGGCCGTGTTTTGGGTCGCTGTTGTTATCGGCTTGGCTGCC
ATGGGCATCAATTTCATCATTCGGATTCCCGAGGCGTCGGCGGAGTTGACGGTGGATGAGAGGGATGAGTTGGGG
TGGGAGGATTGGAAGCGAAACATGGTCGACGCCCGGATCGAGCAGGCCTTTGCGGCGGGCCGCGTTCCGTCCAAC
ATTACGCGCGAGTATCTCTCGAGGAATCGTGACGGGGAGGGCATCAGCGGTATCGTCGTCATCACTCTGCTCGTC
AGCGCCGTCGTCGTCTCGAGGCTGCTCACGCGGGCGCTGGTCGTCAAGAGGCTCGGGCTGGATGATGGACTGGCG
CTGGCATCGCTGTTGCTCTTCATCCCCTTCGCCATCACCTGCACGCAAATGATCCTCTACGGCTCAGGACGTCCC
TTCATCTTCCGCAAGCTCATCCTCCCAGACGAGCAGTTCGACGTAACCCAATCACTCGACACCATCTCCCAACTC
CTCTACGCAACAGCCATGATCCTAGGTCGAGCTTCGGGCCTGGCCTTCTACCACCGAATCTGCGCGCTGTACAAC
GAGTTTCTCATCATCATCAAGTTCATCTTGTGCATCATCTTCCTCGGCTACCTGGCGCAGATGAGCTTGATCATC
CTGCACTGCCTGCCGCTCACCACGCTTTGGGAGCCGTCGCCGAGGGAAAAGTACAAGTGTATGCAGTGGATCGAC
GTTCAGGGCGTCAACTCTGCCGTTTCTTTGCTTTCGGATCTGCTGGTTTTCGGTGTGCCCTTGGCCATGTTGCGC
GTTCTCAAGTCGATGGATAGGAAGCGCAAGGTTCAGCTTAGCTGTATCTTCTTTCCGGGCCTTGTGGTCGTCTTC
ATCTCCATCGCTCGCATTGCCTTGGCCATCATCTGGAACTGCAAGTCTTCCTTCCCCTATCCTCCAATCCGATAA
Transcript >Ophcf2|06772
ATGGACCGCATACGCAATGAGAAGAAGCAGGCCAACATACAGTCATCCGGACAGGGCATCGAGACGGAAGCAGTT
GCCGAGGCAGACGCCGATGTCGAAGGCTGGTGTACGACCACCACGTCCGACTTTGACTTCAAGAGGCTTGGTTGG
CAGCGGCCGGCCGAGTTTAAGGATGCTTGGGTTGAGGCTTGCTTTGTGCTCTCTTCGGTAGGGGCCTTGGCCATG
GCTGACTTCATCGTCGACGGCTTTCAAGTCTTGCTTCCCGCCCTCATCGACCCTCTTTCCATCCCGCCCGGGGCG
CAAATCTGGCCTTCGAGTGTCGTCACCATGGTGGCCGGCTCGTTTCTCTTCCCTCTGGGAAGGCTGACGGACATG
TACGGCGGTTACCTCGTCTTCAACGGAGGGTTGATGTGGTTCACGCTGTGGACGCTGGCCGCGGGATTCGCCACC
GATTTCATATTCCTCGTCTTTTGCAGGGCCATGCAGGGCTTGGGTATGGCTGCCTTCTTGCCTGCCGGGATTGCT
CTCCTCGGCCGCTTCTACAGACCCGGTCCTCGGAAGAACGTCGTGTTTGCGCTCTACGGTGCCGCCTGTCCGGTC
GGCTTCTTCGGAGGCGTCTTGACGGCGGGGTTCTCGCAAGAGGTCTTGGGGCAGTGGCGGTCTTTCTTCTGGGTT
GGGGGGTTGGTTACGGGTGTTTGCTGTGTTGGGACTGTGCTTTACAGTCCGAGGGATGAGGGTCATGGGGTTCCT
ATGGATTGGCCCGGGACGCTGACGACTGTTCCGGCCATCATGCTGTTGCTCTACGCTGCGGCCAAGGGGACGGGG
TCCGACATGGGGTTCATGACGCCCGATGTTGTTGTCGCTTTGGTCATGGGGGTTGTTTTCTTGGGGTTGGCTGTC
GTGGTCGAGACGAGGGTTGAGTCTCCGTTGATACCGGTTGAAATCTTCAGGATCAAGGATATGAAGGCTATGCTG
TTGTATCTGCTGCTGTCATGGGGTGTTTACTCCATGTATCAGTTTTACACCAGCTTCTACATGCAGATGGTGCTG
AACCTGTCGTCCCTGACGACGGCTCTCTGGTACGCCCCCTGGGCTGTTGGCGGTCTTCTCCTTTCGACGCTGGGT
GGTCTCGTCCTCGATAGGATCCCAGCGTCTTGGCTGCTCATCCCGTCGAGCATCTCGGCCATAATGGCCGTTCTT
CTCTTCGCCATCATGCCGACCGAACCGAGCTACTGGCTCTGGATCTTCCCGGCCATGATCTTCGAGGCGGCATCG
GCCGATATTCTATGGACGGTGAGCAACGTCTTCCTAACCACCAGCCTCCCCCGACACCATCAGGGCCTCGCCGGC
GCCATCATCAGCCTGACTCTCTTCGTGGGCGACGCCTTCTTCCTGGCCGTAGGCGACGTCGTCGAGGAGTCGATG
GCCAGAGCCGGGAAGGGGGCTCGGACGCAGTACAAGGCCGTGTTTTGGGTCGCTGTTGTTATCGGCTTGGCTGCC
ATGGGCATCAATTTCATCATTCGGATTCCCGAGGCGTCGGCGGAGTTGACGGTGGATGAGAGGGATGAGTTGGGG
TGGGAGGATTGGAAGCGAAACATGGTCGACGCCCGGATCGAGCAGGCCTTTGCGGCGGGCCGCGTTCCGTCCAAC
ATTACGCGCGAGTATCTCTCGAGGAATCGTGACGGGGAGGGCATCAGCGGTATCGTCGTCATCACTCTGCTCGTC
AGCGCCGTCGTCGTCTCGAGGCTGCTCACGCGGGCGCTGGTCGTCAAGAGGCTCGGGCTGGATGATGGACTGGCG
CTGGCATCGCTGTTGCTCTTCATCCCCTTCGCCATCACCTGCACGCAAATGATCCTCTACGGCTCAGGACGTCCC
TTCATCTTCCGCAAGCTCATCCTCCCAGACGAGCAGTTCGACGTAACCCAATCACTCGACACCATCTCCCAACTC
CTCTACGCAACAGCCATGATCCTAGGTCGAGCTTCGGGCCTGGCCTTCTACCACCGAATCTGCGCGCTGTACAAC
GAGTTTCTCATCATCATCAAGTTCATCTTGTGCATCATCTTCCTCGGCTACCTGGCGCAGATGAGCTTGATCATC
CTGCACTGCCTGCCGCTCACCACGCTTTGGGAGCCGTCGCCGAGGGAAAAGTACAAGTGTATGCAGTGGATCGAC
GTTCAGGGCGTCAACTCTGCCGTTTCTTTGCTTTCGGATCTGCTGGTTTTCGGTGTGCCCTTGGCCATGTTGCGC
GTTCTCAAGTCGATGGATAGGAAGCGCAAGGTTCAGCTTAGCTGTATCTTCTTTCCGGGCCTTGTGGTCGTCTTC
ATCTCCATCGCTCGCATTGCCTTGGCCATCATCTGGAACTGCAAGTCTTCCTTCCCCTATCCTCCAATCCGATAA
Gene >Ophcf2|06772
ATGGACCGCATACGCAATGAGAAGAAGCAGGCCAACATACAGTCATCCGGACAGGGCATCGAGACGGAAGCAGTT
GCCGAGGCAGACGCCGATGTCGAAGGCTGGTGTACGACCACCACGTCCGACTTTGACTTCAAGAGGCTTGGTTGG
CAGCGGCCGGCCGAGTTTAAGGATGCTTGGGTTGAGGCTTGCTTTGTGCTCTCTTCGGTAGGGGCCTTGGCCATG
GCTGTGAGTCTTTTTCATGGTGGGAGTTGAGGGTGCTGTCACTTACACGTGTAGGACTTCATCGTCGACGGCTTT
CAAGTCTTGCTTCCCGCCCTCATCGACCCTCTTTCCATCCCGCCCGGGGCGCAAATCTGGCCTTCGAGTGTCGTC
ACCATGGTGGCCGGCTCGTTTCTCTTCCCTCTGGGAAGGCTGACGGACATGTACGGCGGTTACCTCGTCTTCAAC
GGAGGGTTGATGTGGTTCACGCTGTGGACGCTGGCCGCGGGATTCGCCACCGATTTCATATTCCTCGTCTTTTGC
AGGGCCATGCAGGGCTTGGGTATGGCTGCCTTCTTGCCTGCCGGGATTGCTCTCCTCGGCCGCTTCTACAGACCC
GGTCCTCGGAAGAACGTCGTGTTTGCGCTCTACGGTGCCGCCTGTCCGGTCGGCTTCTTCGGAGGCGTCTTGACG
GCGGGGTTCTCGCAAGAGGTCTTGGGGCAGTGGCGGTCTTTCTTCTGGGTTGGGGGGTTGGTTACGGGTGTTTGC
TGTGTTGGGACTGTGCTTTACAGTCCGAGGGATGAGGGTCATGGGGTTCCTATGGATTGGCCCGGGACGCTGACG
ACTGTTCCGGCCATCATGCTGTTGCTCTACGCTGCGGCCAAGGGGACGGGGTCCGACATGGGGTTCATGACGCCC
GATGTTGTTGTCGCTTTGGTCATGGGGGTTGTTTTCTTGGGGTTGGCTGTCGTGGTCGAGACGAGGGTTGAGTCT
CCGTTGATACCGGTTGAAATCTTCAGGATCAAGGATATGAAGGCTATGCTGTTGTATCTGCTGCTGTCATGGGGT
GTTTACTCCATGTATCAGTTTTACACCAGCTTCTAGTACGTGGACTCCCCCCCCCCCCTCTCACCCCTTTTCTGA
TCTGGAGTTTGGTGACTGACTTCGATGGTTGGTCGTTACAGCATGCAGATGGTGCTGAACCTGTCGTCCCTGACG
ACGGCTCTCTGGTACGCCCCCTGGGCTGTTGGCGGTCTTCTCCTTTCGACGCTGGGTGGTCTCGTCCTCGATAGG
ATCCCAGCGTCTTGGCTGCTCATCCCGTCGAGCATCTCGGCCATAATGGCCGTTCTTCTCTTCGCCATCATGCCG
ACCGAACCGAGCTACTGGCTCTGGATCTTCCCGGCCATGATCTTCGAGGCGGCATCGGCCGATATTCTATGGACG
GTGAGCAACGTCTTCCTAACCACCAGCCTCCCCCGACACCATCAGGGCCTCGCCGGCGCCATCATCAGCCTGACT
CTCTTCGTGGGCGACGCCTTCTTCCTGGCCGTAGGCGACGTCGTCGAGGAGTCGATGGCCAGAGCCGGGAAGGGG
GCTCGGACGCAGTACAAGGCCGTGTTTTGGGTCGCTGTTGTTATCGGCTTGGCTGCCATGGGCATCAATTTCATC
ATTCGGATTCCCGAGGCGTCGGCGGAGTTGACGGTGGATGAGAGGGATGAGTTGGGGTGGGAGGATTGGAAGCGT
GGGAGGGAGGATTCTATGACGGATGCTGAGACGGTGGTTGGGTGTGAGATGGAGGACTTGTTGAAGGCTTCGGAG
TGTCGAGGAGGGTCATGAGGAGAAGTAATGAAAGAAGTAGCGTAGATTTGCATGGGTTTGGTTGTGGTGATGCAA
CATGGTCTGGATCAACGTGAAGGATGATCTCGCAGGCAATATAGAAGACGGAGCCTCAAAGACTTGGTTCAAAAG
TAAGGACGGTCTGATGGACGATATACGAGACACAGACTCAAAGACTTGGCTGTCAAGCCCCAGATGATCAACATG
AAGGATGACCCCATAAACAACAAGACACAGCCTCAAGGCTCACCTGCCAAACCCTAGATGATCAACATGAAAGAT
GACCCCATAAACAACAATACACAGCCTCAAAGACTCTGGCAAACCCCAGATGAGCAAGCATCCCCATCCAACCTC
CACGTTTCAACCTCAAGCCAAACACCACCACCAAGACCCCGACTCAGCACACCACCCAACCGGCCCGTCAACGAA
TCAAGCCCCAATCAGACGACACGCTCGGCCTCGTCTGAAGCGGTAGCGTCCCGTCCCAATTCGGCAAAGGCGCTC
GTTTCAGCCAGGACTCGTCGTTTTACCGGCTTTCTCGAGAGGGGCGTGGTCTCGGCGACTGGGTGCCGCGGACGG
GGCCTATTGTTCGGGGTTGCGAGTCGTGGGAGATGAGGCGAGGCTGATTTGTAAAGAGGATTGTTGTTCCGGCTC
TTTGAAATCTTTCCTTGTCCGAGACTTTGATGCTCTTTTGGATAGATTCGAGGGAAACAGACGAGTGATTGTCAA
AGGAACAAGGGGGGGAAATACGTCGATCCATCTCGAGGCCGGTCCTGGGAATAAACCAGCTTCTTCTTCTTCTTC
TTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCCTTTTCTTCTTCTCCTCCTTCTTTTCCTCGGTT
ACATGTACGAGCAGGAAACATGGTCGACGCCCGGATCGAGCAGGCCTTTGCGGCGGGCCGCGTTCCGTCCAACAT
TACGCGCGAGTATCTCTCGAGGAATCGTGACGGGGAGGGCATCAGCGGTATCGTCGTCATCACTCTGCTCGTCAG
CGCCGTCGTCGTCTCGAGGCTGCTCACGCGGGCGCTGGTCGTCAAGAGGCTCGGGCTGGATGATGGACTGGCGCT
GGCATCGCTGGTAAGATGGGATAACCTCTTCCTTCATCTCACAGACCAGAGACGAGGCTTTCTAACTCGGCTTCA
CAGTTGCTCTTCATCCCCTTCGCCATCACCTGCACGCAAATGATCCTCTACGGCTCAGGACGTCCCTTCATCTTC
CGCAAGCTCATCCTCCCAGACGAGCAGTTCGACGTAACCCAATCACTCGACACCATCTCCCAACTCCTCTACGCA
ACAGCCATGATCCTAGGTCGAGCTTCGGGCCTGGCCTTCTACCACCGAATCTGCGCGCTGTACAACGAGTTTCTC
ATCATCATCAAGTTCATCTTGTGCATCATCTTCCTCGGCTACCTGGCGCAGATGAGCTTGATCATCCTGCACTGC
CTGCCGCTCACCACGCTTTGGGAGCCGTCGCCGAGGGAAAAGTACAAGTGTATGCAGTGGATCGACGTTCAGGGC
GTCAACTCTGCCGTTTCTTTGCTTTCGGATCTGCTGGTTTTCGGTGTGCCCTTGGCCATGTTGCGCGTTCTCAAG
TCGATGGATAGGAAGCGCAAGGTTCAGCTTAGCTGTATCTTCTTTCCGGGCCTTGTGTGAGTTGTCTTGACGTTG
AAGCCTTTAACTTTGGACTCTTTCTTTCGAACTAACAGCAACCAGGGTCGTCTTCATCTCCATCGCTCGCATTGC
CTTGGCCATCATCTGGAACTGCAAGTCTTCCTTCCCCTATCCTCCAATCCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail