Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06763
Gene name
Locationscaffold_08:999378..1000161
Strand-
Gene length (bp)783
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08555 FAM32A FAM32A 4.8E-07 10 84

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4336 0.7645 0.1273 0.0701 0.0624 0.0199 0.1498 0.1022 0.1677 0.0098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1831
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5588
Ophiocordyceps australis map64 (Brazil) OphauB2|1030
Ophiocordyceps camponoti-floridani Ophcf2|06763 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5759
Ophiocordyceps kimflemingae Ophio5|1412
Ophiocordyceps subramaniannii Hirsu2|182

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06763
MPSDEYVAVGGSGALRLKGGKVQKHKKKKKTDKSKEKEVAEKLSRPKTPDPDAGPGPDDDDDVPAQKTESERRYE
EAKKKRMLQMTQASGARPELLKTHKERGTRPTHDVAALGYTLSSPFRKSWPEKECLVLCIDIQLHTSCRHYASRP
PWSRFKNPQYLHLCPIQVLFSCAADTVSPKSKGD*
Coding >Ophcf2|06763
ATGCCCTCGGACGAATACGTTGCTGTCGGAGGATCCGGCGCCCTGCGGCTGAAAGGCGGTAAAGTGCAGAAGCAC
AAGAAAAAGAAGAAGACGGATAAGAGCAAGGAAAAGGAAGTTGCCGAAAAGCTGTCCCGACCGAAGACGCCCGAC
CCCGACGCCGGTCCCGGCCCCGATGACGATGATGACGTTCCGGCGCAAAAGACGGAGTCTGAGCGTCGCTACGAA
GAGGCCAAGAAGAAGCGCATGCTCCAGATGACACAGGCTTCCGGCGCCAGGCCCGAGCTGCTCAAGACTCACAAA
GAGCGCGGGACACGCCCGACTCATGACGTTGCGGCGTTGGGATATACCCTATCTTCACCATTCCGCAAGTCATGG
CCGGAAAAGGAGTGTCTGGTATTGTGTATCGACATCCAGCTGCACACATCCTGTCGCCATTATGCCTCCAGACCA
CCATGGTCTCGATTCAAGAATCCCCAATATCTCCATCTCTGTCCAATCCAAGTACTTTTCTCCTGCGCTGCCGAT
ACTGTCTCTCCAAAGTCAAAGGGTGATTAA
Transcript >Ophcf2|06763
ATGCCCTCGGACGAATACGTTGCTGTCGGAGGATCCGGCGCCCTGCGGCTGAAAGGCGGTAAAGTGCAGAAGCAC
AAGAAAAAGAAGAAGACGGATAAGAGCAAGGAAAAGGAAGTTGCCGAAAAGCTGTCCCGACCGAAGACGCCCGAC
CCCGACGCCGGTCCCGGCCCCGATGACGATGATGACGTTCCGGCGCAAAAGACGGAGTCTGAGCGTCGCTACGAA
GAGGCCAAGAAGAAGCGCATGCTCCAGATGACACAGGCTTCCGGCGCCAGGCCCGAGCTGCTCAAGACTCACAAA
GAGCGCGGGACACGCCCGACTCATGACGTTGCGGCGTTGGGATATACCCTATCTTCACCATTCCGCAAGTCATGG
CCGGAAAAGGAGTGTCTGGTATTGTGTATCGACATCCAGCTGCACACATCCTGTCGCCATTATGCCTCCAGACCA
CCATGGTCTCGATTCAAGAATCCCCAATATCTCCATCTCTGTCCAATCCAAGTACTTTTCTCCTGCGCTGCCGAT
ACTGTCTCTCCAAAGTCAAAGGGTGATTAA
Gene >Ophcf2|06763
ATGCCCTCGGACGAATACGTTGCTGTCGGAGGATCCGGCGCCCTGCGGCTGAAAGGCGGTAAAGTGCAGAAGCAC
AAGAAAAAGAAGAAGACGGATAAGAGCAAGGAAAAGGAAGTTGCCGAAAAGCTGTCCCGACCGAAGACGCCCGAC
CCCGACGCCGGTCCCGGCCCCGATGACGATGATGACGTTCCGGCGCAAAAGACGGAGTCTGAGCGTCGCTACGAA
GAGGCCAAGAAGAAGCGCGTGAGTAGCTCAGTCCCGTCTGCCGAAACCGATCGTCTCGCCGTCTAACTGCCACGC
GTACAGATGCTCCAGATGACACAGGCTTCCGGCGCCAGGCCCGAGCTGCTCAAGACTCACAAAGAGCGCGTTGAG
GAGCTCAACACATATCTTTCCAAGCTCAGCGAACATCACGATATGCCCAAGATCGGTCCGGGATAGGGGACACGC
CCGACTCATGACGTTGCGGCGTTGGGATATACCCTATCTTCACCATGTATGTACGAATGCCAGGGTCGTCATGAT
AGACTTTTCTTGCCTCACCATTCAGACAACGCCCACGTGGCGTCGGCTAACAAACAAGGTCTAGTCCGCAAGTCA
TGGCCGGAAAAGGAGTGTCTGGTATTGTGTATCGACATCCAGCTGCACACATCCTGTCGCCATTATGCCTCCAGA
CCACCATGGTCTCGATTCAAGAATCCCCAATATCTCCATCTCTGTCCAATCCAAGTACTTTTCTCCTGCGCTGCC
GATACTGTCTCTCCAAAGTCAAAGGGTGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail