Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06760
Gene name
Locationscaffold_08:988407..993196
Strand+
Gene length (bp)4789
Transcript length (bp)2895
Coding sequence length (bp)2895
Protein length (aa) 965

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04084 ORC2 Origin recognition complex subunit 2 2.3E-66 782 954
PF00067 p450 Cytochrome P450 3.5E-60 179 596

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0005634 nucleus Yes
GO:0000808 origin recognition complex Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0006259 DNA metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0046483 heterocycle metabolic process No
GO:0003824 catalytic activity No
GO:0043227 membrane-bounded organelle No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0071704 organic substance metabolic process No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 76 95 19
2 105 127 22
3 140 162 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 28.28 16.13 40.42
Alive In ants, during behavior modification 33.42 18.93 47.90
Dead In ants, recently dead 22.79 12.80 32.78

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.414488 no
Alive Dead 0.016191 yes
Dead Fungus 0.269894 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06760
MKRAGKTSETNDGDNFRRGAERPSGRGGRTDTHKSPTNLPGPEVDDIRRQLEDSDDDYINAYINATMATIVDDLA
SSPIRAAVFLAGVLFHVAVFRHGEWHLQAPRLVACLAFLSTAMPCALLWRFPELSSVAWLVLKTTSWLVLAFLAG
LGGSVMVYRAAFHPLGRFPGPFGARLSNLYMTMLDVRGQIFCETRKLHDLYGDIVRVGPSELSIRKMSAIKTIHS
GSSPCIKGPWYDMLRPEDGLNSTRDKKEHSLRRKAWDKAFGGKALRDYESRVAHYTAQLVDVIDESQGQAVNASN
LFVFYGFDVMGEIGFGRSFSILSDGVLPEAIGMARNFMALIGAYRRLLWQSRVLIAVPALSQALRAFNRWISRHI
AAMEQSASDRPTVFSSVMSDYEAKGQLTRPYPPQLIADARLVVVAGSDTTAAALTCLFFELALHPETRATLQAEL
NRSETADDAALSKIEYLGACINETLRLYPPVMSGLSRQTPPEGLLIDDVFIPGDTIVQIPTYAMSRDERFFVDPD
RFIPERWTTKPELTKEGAASVPFSYGPYACVGMALAMMELRYATARIVSRFDVELAPDCSPSAFKKGMFDVFTLV
APGLRLVFRPREAKATPSVWDIMVAALAGSAGCGWLSRSRRRSPIPIETAPNRPPPTKPPPHELYFQNNRPGRPQ
TSDATLSQLTPLTHEEFFRLRAQQQQKKKKKTKKKKGVDAGVAALEALHEESFAQWAFEKEGLGEGDDLFHRYGR
GTHLYLNDDDDNKPPRISNNPPNPTNQLHRRPPLRKPSSQALLARLATHPRIRLITSADTPDFPLLWDVGLRSAF
NFIFHDATTYAPLDVEMDAVDVVNRLLGRSAARLHAREGVAFVLRSLPENAKSLFRLLVGEVLVAMEEGDEVAAV
EYRIVYNKAVEEFVCSSEMAFRTLLKEFHDHQIITSRKDVVGTELLSVPFPRDELEAMLEDMMA*
Coding >Ophcf2|06760
ATGAAGAGAGCGGGCAAGACGAGCGAAACAAATGATGGCGATAACTTCAGGCGAGGAGCAGAACGGCCAAGTGGT
CGGGGCGGACGGACCGATACACACAAATCGCCTACCAATCTACCAGGTCCTGAGGTAGACGATATCCGGAGACAA
CTTGAAGACAGTGACGACGATTACATAAATGCATACATAAATGCAACCATGGCCACAATCGTCGATGACCTCGCC
TCTTCCCCCATCCGTGCCGCCGTCTTCCTCGCTGGCGTCTTGTTTCACGTGGCCGTCTTCCGTCATGGCGAGTGG
CATCTTCAGGCTCCGAGGCTGGTGGCCTGCCTCGCCTTTCTCTCTACCGCCATGCCCTGCGCTCTCCTCTGGCGC
TTCCCCGAGCTGTCGAGCGTAGCTTGGCTGGTGCTGAAGACGACGTCGTGGCTGGTGCTTGCTTTCCTGGCCGGC
CTGGGCGGCAGTGTCATGGTCTATCGGGCTGCCTTTCATCCCCTTGGCCGCTTCCCCGGACCTTTTGGGGCGAGG
CTGTCGAACCTGTACATGACGATGCTGGACGTCAGGGGACAGATCTTTTGCGAGACGCGCAAGTTGCACGATCTA
TACGGGGACATCGTCCGTGTCGGCCCGTCGGAGCTGTCCATCAGGAAAATGAGCGCCATAAAAACCATCCACTCC
GGCAGTTCCCCCTGCATCAAGGGCCCTTGGTACGACATGCTCAGACCCGAGGATGGACTGAATTCGACCCGGGAC
AAGAAGGAGCACAGCCTTCGACGCAAGGCTTGGGACAAGGCTTTCGGTGGCAAGGCTCTGCGAGACTACGAGTCT
CGAGTGGCACACTACACAGCCCAGCTCGTAGACGTCATTGACGAGTCGCAGGGACAAGCCGTCAACGCGTCGAAC
CTCTTCGTCTTTTACGGCTTCGACGTCATGGGCGAGATCGGCTTCGGTAGGAGCTTCAGCATCCTCTCCGACGGA
GTACTGCCCGAGGCCATCGGCATGGCGCGCAACTTCATGGCCCTCATCGGTGCCTATCGACGACTGTTGTGGCAG
TCTCGCGTCCTGATCGCCGTTCCCGCCCTCTCACAAGCTTTGCGGGCCTTTAACCGTTGGATATCTCGCCACATT
GCGGCCATGGAGCAGTCTGCCTCGGACCGACCGACCGTCTTCTCCTCCGTCATGTCCGACTACGAGGCCAAGGGT
CAACTGACGAGGCCGTACCCGCCGCAGTTGATTGCAGACGCAAGGCTTGTTGTCGTCGCGGGCAGTGATACAACG
GCCGCTGCTCTCACCTGTCTATTCTTCGAACTGGCCCTTCATCCAGAGACGCGGGCGACGCTCCAGGCCGAGCTG
AATCGGTCTGAGACGGCCGATGACGCGGCCCTGTCCAAGATTGAATATCTGGGCGCCTGTATCAATGAGACGCTG
CGGCTCTATCCGCCGGTCATGTCCGGGTTGTCGCGGCAGACGCCGCCCGAGGGTTTACTCATCGACGACGTCTTT
ATACCTGGCGATACCATTGTGCAGATACCGACGTACGCCATGAGCCGCGACGAGCGCTTCTTCGTCGACCCAGAC
CGCTTCATCCCCGAGCGCTGGACGACCAAACCCGAGCTCACCAAAGAGGGCGCCGCCTCGGTCCCCTTCTCGTAC
GGCCCGTACGCGTGCGTCGGCATGGCCCTAGCCATGATGGAGCTCCGATACGCGACGGCACGGATCGTGTCCCGC
TTCGACGTGGAGCTGGCGCCGGACTGCTCGCCGTCGGCCTTTAAGAAGGGCATGTTCGATGTCTTCACCCTGGTG
GCGCCGGGTCTGAGGCTGGTCTTTCGACCTCGAGAGGCCAAGGCGACGCCTTCGGTTTGGGACATTATGGTCGCA
GCTCTGGCCGGTTCAGCTGGTTGTGGATGGCTTTCAAGGTCTCGACGAAGAAGCCCAATCCCCATCGAAACCGCC
CCCAACCGCCCCCCCCCAACCAAGCCTCCCCCCCACGAGCTCTACTTCCAAAACAACCGCCCCGGCCGCCCGCAA
ACATCCGACGCCACGCTCTCGCAACTCACACCGCTGACCCACGAAGAGTTCTTCCGGCTGCGGGCCCAGCAGCAG
CAGAAGAAGAAGAAGAAGACGAAGAAGAAGAAGGGTGTGGACGCGGGGGTGGCTGCTTTGGAGGCGCTGCATGAG
GAGTCGTTTGCGCAGTGGGCTTTCGAGAAGGAGGGTCTTGGAGAGGGAGATGATCTCTTCCATCGCTACGGCCGT
GGGACTCACCTCTACCTCAACGACGACGACGACAACAAGCCTCCTCGCATCTCTAACAACCCCCCTAACCCTACA
AATCAACTCCATCGACGCCCCCCCCTCCGAAAACCCTCCTCCCAAGCCCTCCTCGCCCGCCTAGCGACCCACCCC
CGCATCCGGCTCATCACCTCGGCCGACACGCCCGACTTCCCACTACTATGGGACGTAGGCCTCCGATCGGCCTTC
AACTTCATCTTCCACGACGCCACGACGTACGCGCCGCTGGACGTGGAGATGGACGCGGTCGACGTGGTCAACCGC
CTGCTCGGGAGGTCCGCTGCCCGGCTCCACGCGAGGGAGGGCGTGGCTTTCGTGCTGCGCAGCTTGCCGGAGAAT
GCCAAGAGCCTGTTTCGTCTTCTCGTCGGCGAGGTGTTGGTCGCCATGGAGGAGGGCGATGAGGTTGCGGCGGTG
GAGTATCGGATTGTTTACAACAAGGCGGTTGAGGAGTTTGTCTGCTCTTCTGAGATGGCGTTTCGTACCTTGCTC
AAAGAGTTTCACGATCATCAGATCATCACCAGTCGCAAGGACGTCGTCGGCACTGAACTCTTGAGCGTGCCCTTT
CCTCGCGATGAGTTGGAAGCTATGCTGGAGGACATGATGGCATGA
Transcript >Ophcf2|06760
ATGAAGAGAGCGGGCAAGACGAGCGAAACAAATGATGGCGATAACTTCAGGCGAGGAGCAGAACGGCCAAGTGGT
CGGGGCGGACGGACCGATACACACAAATCGCCTACCAATCTACCAGGTCCTGAGGTAGACGATATCCGGAGACAA
CTTGAAGACAGTGACGACGATTACATAAATGCATACATAAATGCAACCATGGCCACAATCGTCGATGACCTCGCC
TCTTCCCCCATCCGTGCCGCCGTCTTCCTCGCTGGCGTCTTGTTTCACGTGGCCGTCTTCCGTCATGGCGAGTGG
CATCTTCAGGCTCCGAGGCTGGTGGCCTGCCTCGCCTTTCTCTCTACCGCCATGCCCTGCGCTCTCCTCTGGCGC
TTCCCCGAGCTGTCGAGCGTAGCTTGGCTGGTGCTGAAGACGACGTCGTGGCTGGTGCTTGCTTTCCTGGCCGGC
CTGGGCGGCAGTGTCATGGTCTATCGGGCTGCCTTTCATCCCCTTGGCCGCTTCCCCGGACCTTTTGGGGCGAGG
CTGTCGAACCTGTACATGACGATGCTGGACGTCAGGGGACAGATCTTTTGCGAGACGCGCAAGTTGCACGATCTA
TACGGGGACATCGTCCGTGTCGGCCCGTCGGAGCTGTCCATCAGGAAAATGAGCGCCATAAAAACCATCCACTCC
GGCAGTTCCCCCTGCATCAAGGGCCCTTGGTACGACATGCTCAGACCCGAGGATGGACTGAATTCGACCCGGGAC
AAGAAGGAGCACAGCCTTCGACGCAAGGCTTGGGACAAGGCTTTCGGTGGCAAGGCTCTGCGAGACTACGAGTCT
CGAGTGGCACACTACACAGCCCAGCTCGTAGACGTCATTGACGAGTCGCAGGGACAAGCCGTCAACGCGTCGAAC
CTCTTCGTCTTTTACGGCTTCGACGTCATGGGCGAGATCGGCTTCGGTAGGAGCTTCAGCATCCTCTCCGACGGA
GTACTGCCCGAGGCCATCGGCATGGCGCGCAACTTCATGGCCCTCATCGGTGCCTATCGACGACTGTTGTGGCAG
TCTCGCGTCCTGATCGCCGTTCCCGCCCTCTCACAAGCTTTGCGGGCCTTTAACCGTTGGATATCTCGCCACATT
GCGGCCATGGAGCAGTCTGCCTCGGACCGACCGACCGTCTTCTCCTCCGTCATGTCCGACTACGAGGCCAAGGGT
CAACTGACGAGGCCGTACCCGCCGCAGTTGATTGCAGACGCAAGGCTTGTTGTCGTCGCGGGCAGTGATACAACG
GCCGCTGCTCTCACCTGTCTATTCTTCGAACTGGCCCTTCATCCAGAGACGCGGGCGACGCTCCAGGCCGAGCTG
AATCGGTCTGAGACGGCCGATGACGCGGCCCTGTCCAAGATTGAATATCTGGGCGCCTGTATCAATGAGACGCTG
CGGCTCTATCCGCCGGTCATGTCCGGGTTGTCGCGGCAGACGCCGCCCGAGGGTTTACTCATCGACGACGTCTTT
ATACCTGGCGATACCATTGTGCAGATACCGACGTACGCCATGAGCCGCGACGAGCGCTTCTTCGTCGACCCAGAC
CGCTTCATCCCCGAGCGCTGGACGACCAAACCCGAGCTCACCAAAGAGGGCGCCGCCTCGGTCCCCTTCTCGTAC
GGCCCGTACGCGTGCGTCGGCATGGCCCTAGCCATGATGGAGCTCCGATACGCGACGGCACGGATCGTGTCCCGC
TTCGACGTGGAGCTGGCGCCGGACTGCTCGCCGTCGGCCTTTAAGAAGGGCATGTTCGATGTCTTCACCCTGGTG
GCGCCGGGTCTGAGGCTGGTCTTTCGACCTCGAGAGGCCAAGGCGACGCCTTCGGTTTGGGACATTATGGTCGCA
GCTCTGGCCGGTTCAGCTGGTTGTGGATGGCTTTCAAGGTCTCGACGAAGAAGCCCAATCCCCATCGAAACCGCC
CCCAACCGCCCCCCCCCAACCAAGCCTCCCCCCCACGAGCTCTACTTCCAAAACAACCGCCCCGGCCGCCCGCAA
ACATCCGACGCCACGCTCTCGCAACTCACACCGCTGACCCACGAAGAGTTCTTCCGGCTGCGGGCCCAGCAGCAG
CAGAAGAAGAAGAAGAAGACGAAGAAGAAGAAGGGTGTGGACGCGGGGGTGGCTGCTTTGGAGGCGCTGCATGAG
GAGTCGTTTGCGCAGTGGGCTTTCGAGAAGGAGGGTCTTGGAGAGGGAGATGATCTCTTCCATCGCTACGGCCGT
GGGACTCACCTCTACCTCAACGACGACGACGACAACAAGCCTCCTCGCATCTCTAACAACCCCCCTAACCCTACA
AATCAACTCCATCGACGCCCCCCCCTCCGAAAACCCTCCTCCCAAGCCCTCCTCGCCCGCCTAGCGACCCACCCC
CGCATCCGGCTCATCACCTCGGCCGACACGCCCGACTTCCCACTACTATGGGACGTAGGCCTCCGATCGGCCTTC
AACTTCATCTTCCACGACGCCACGACGTACGCGCCGCTGGACGTGGAGATGGACGCGGTCGACGTGGTCAACCGC
CTGCTCGGGAGGTCCGCTGCCCGGCTCCACGCGAGGGAGGGCGTGGCTTTCGTGCTGCGCAGCTTGCCGGAGAAT
GCCAAGAGCCTGTTTCGTCTTCTCGTCGGCGAGGTGTTGGTCGCCATGGAGGAGGGCGATGAGGTTGCGGCGGTG
GAGTATCGGATTGTTTACAACAAGGCGGTTGAGGAGTTTGTCTGCTCTTCTGAGATGGCGTTTCGTACCTTGCTC
AAAGAGTTTCACGATCATCAGATCATCACCAGTCGCAAGGACGTCGTCGGCACTGAACTCTTGAGCGTGCCCTTT
CCTCGCGATGAGTTGGAAGCTATGCTGGAGGACATGATGGCATGA
Gene >Ophcf2|06760
ATGAAGAGAGCGGGCAAGACGAGCGAAACAAATGATGGCGATAACTTCAGGCGAGGAGCAGAACGGCCAAGTGGT
CGGGGCGGACGGACCGATACACACAAATCGCCTACCAATCTACCAGGTCCTGAGGTAGGTGAGTCAAGTCCTCTG
TTCGTATTCGTGTATCCTGCAGTTCCAGCTACTCTGAAGGTTGATTGGACCTGGAGCTGACTGTTGCTGGGCATC
TGACTCTTTCCGAGACAGACGATATCCGGAGACAACTTGAAGACAGTGACGACGATTACATAAATGCATACATAA
ATGGTAAAGGGCGTCTATTGGATCCACTCGAATAACTTCTCTGCTTCATCCAGCAACCATGGCCACAATCGTCGA
TGACCTCGCCTCTTCCCCCATCCGTGCCGCCGTCTTCCTCGCTGGCGTCTTGTTTCACGTGGCCGTCTTCCGTCA
TGGCGAGTGGCATCTTCAGGCTCCGAGGCTGGTGGCCTGCCTCGCCTTTCTCTCTACCGCCATGCCCTGCGCTCT
CCTCTGGCGCTTCCCCGAGCTGTCGAGCGTAGCTTGGCTGGTGCTGAAGACGACGTCGTGGCTGGTGCTTGCTTT
CCTGGCCGGCCTGGGCGGCAGTGTCATGGTCTATCGGGCTGCCTTTCATCCCCTTGGCCGCTTCCCCGGACCTTT
TGGGGCGAGGCTGTCGAACCTGTACATGACGATGCTGGACGTCAGGGGACAGATCTTTTGCGAGACGCGCAAGTT
GCACGATCTATACGGGGACATCGTCCGTGTCGGCGAGTCTTTTCATTCTTCCTCTCATGCTCTCCATCTGTATTG
ACCCAGCCTGTACAGGCCCGTCGGAGCTGTCCATCAGGAAAATGAGCGCCATAAAAACCATCCACTCCGGCAGTT
CCCCCTGCATCAAGGGCCCTTGGTACGACATGCTCAGACCCGAGGATGGACTGAATTCGACCCGGGACAAGAAGG
AGCACAGCCTTCGACGCAAGGCTTGGGACAAGGCTTTCGGTGGCAAGGGTAGGTTCTGCTTCGAAGAGGAGGACG
CTCGCTGAAGCGCTGCAGCTCTGCGAGACTACGAGTCTCGAGTGGCACACTACACAGCCCAGCTCGTAGACGTCA
TTGACGAGTCGCAGGGACAAGCCGTCAACGCGTCGAACCTCTTCGTCTTTTACGGCTTCGACGTCATGGGCGAGA
TCGGCTTCGGTAGGAGCTTCAGCATCCTCTCCGACGGAGTACTGCCCGAGGCCATCGGCATGGCGCGCAACTTCA
TGGCCCTCATCGGTGCCTATCGACGACTGTTGTGGCAGTCTCGCGTCCTGATCGCCGTTCCCGCCCTCTCACAAG
CTTTGCGGGCCTTTAACCGTTGGATATCTCGCCACATTGCGGCCATGGAGCAGGTAAGCCGTTCGCAAGCGTTCC
CCTTGTAGCATGTTTCTTCGGCCGAGACTGACGACGAAGTCAGTCTGCCTCGGACCGACCGACCGTCTTCTCCTC
CGTCATGTCCGACTACGAGGCCAAGGGTCAACTGACGAGGCCGTACCCGCCGCAGTTGATTGCAGACGCAAGGCT
TGTTGTCGTCGCGGGCAGGTGGGCATTTCTGCAGACTTGAACTTGACGAGGAGAGGCTGATGGGTCAGAGGGAAG
TGATACAACGGCCGCTGCTCTCACCTGTCTATTCTTCGAACTGGCCCTTCATCCAGAGACGCGGGCGACGCTCCA
GGCCGAGCTGAATCGGTCTGAGACGGCCGATGACGCGGCCCTGTCCAAGATTGAATATCTGGGCGCCTGTATCAA
TGAGACGCTGCGGCTCTATCCGCCGGTCATGTCCGGGTTGTCGCGGCAGACGCCGCCCGAGGGTTTACTCATCGA
CGACGTCTTTATACCTGGCGATACCATTGTGCAGATACCGACGTACGCCATGAGCCGCGGTGAGTCCTTTTTCCG
CCGACATGGGTTTGTTGACGAGGCTAACCGGCTGTTGTATCAAGACGAGCGCTTCTTCGTCGACCCAGACCGCTT
CATCCCCGAGCGCTGGACGACCAAACCCGAGCTCACCAAAGAGGGCGCCGCCTCGGTCCCCTTCTCGTACGGTAA
GGAGAGCATCCCCCCCCGGTCGAGCAGCCCCCGTTTCTCACGCCCCCTATCCTGTCGTATAGGCCCGTACGCGTG
CGTCGGCATGGCCCTAGCCATGATGGAGCTCCGATACGCGACGGCACGGATCGTGTCCCGCTTCGACGTGGAGCT
GGCGCCGGACTGCTCGCCGTCGGCCTTTAAGAAGGGCATGTTCGATGTCTTCACCCTGGTGGCGCCGGGTCTGAG
GCTGGTCTTTCGACCTCGAGAGGCCAAGGCGGTGAGCTCGTGAGCCTGTTGACAGTCTGCGGGCTGTTCTGAAAT
CGCTCCCTGGCCTCAAAAGGGGGGGGGGCCGAAGTCGGACATTTATATATTTATGTATGCGGACGCGGGAATTTT
CATCGGTACTTCTTCTGGCGACGAGATGGAAGGGCGACCGGAACATGAGGTTTGGTATGAATCAACGGGTGAGCT
GACCATGGGTTATGCCGGTGAAGACGCCTTCGGTTTGGGACATTATGGTCGCAGCTCTGGCCGGTTCAGCTGGTT
GTGGATGGCTTTCAAGGTCTCGGTTGGTTGTGTGGGATTGGATTCTTTTCCTAGATGCGAGATACATGCATACTT
TCGTTCTCCCTAGTTCTTGCAAGCTCAAAGGTTGCCCGTCGCCCTTGGTAATTGTGCAAGCTTGTGCTGGTCTTT
CTTGGGATCCGGGCATCCGGCATCTTGACTTGTCGAGTCGTTGCATAACCTCGGTGAACAAGCCAAAGCTCCCAC
CCCATCGAGAAGCGAACCTCCCGCTTCTGAACCTCGCAGCATGTTTTTGCCCCCGCCGTCTCCTCGCCACAGCCA
TACCCCTCAGCCTGGGCTGCTGCACGCACGAAGGGTTTGGGCTTTCATGGTGTTAAGGCGGTAGTTGGCTGGTTG
ACGCAGAGGGCGCTGTAAAGACGCTGCATCATCGACGAGGGCGACATGGAGGTCCTCTCCATCGGTAGCTGGAAG
TGCAGCAGCGATGTCATGGGGGTTCACGAGCGGGTGTGTCGTCGATGTCTGGGTTTGATAGGCTTTTGAGTGTTG
TTGCTGACATCATGACATGTTTCGCGGGGTTGTGCTACTTACTACCTCTAGGGTAGGGTGAGGTAAGTAGCACGT
CAACCACATCAACTCGGTACCTACCCTATACCCCCAACCCATCACGCGTCGCCCTCACCAACCTCACCTCACCTC
ACTCACCACCAGAACCATCAGCAAACAAAGAAAAAAAAAGAGAGAGAAAAAAAAAATGCCCCCCTCGACGCGAAA
ACGCAGCCAAACAGACGAAGCACAAGCCTCTACACCCTCGAAGCGTCTTCGCAGCAGCGAGCCTGATCCCGAGAC
ACCGAGTGGGCGTACGCCTGGGAGACGACGGGCTGCGGATCGGTCGGCGAGGAGGAAGAGCAAGCGCGCGCTCAT
TAGGAGTGTGACTGGTGGTGACGACGACGACGACGATGACGACGACGATGACTACTATGAGCAGCATCATCATCT
TGCTCGCGATATCCTAACCTCCTCAGACGAAGAAGCCCAATCCCCATCGAAACCGCCCCCAACCGCCCCCCCCCA
ACCAAGCCTCCCCCCCACGAGCTCTACTTCCAAAACAACCGCCCCGGCCGCCCGCAAACATCCGACGCCACGCTC
TCGCAACTCACACCGCTGACCCACGAAGAGTTCTTCCGGCTGCGGGCCCAGCAGCAGCAGAAGAAGAAGAAGAAG
ACGAAGAAGAAGAAGGGTGTGGACGCGGGGGTGGCTGCTTTGGAGGCGCTGCATGAGGAGTCGTTTGCGCAGTGG
GCTTTCGAGAGTAAGCAGGGGTTTAGCCTTTGTCTTTATGGCTTGGGATCTAAGAGGAGGGTCTTGGAGAGGTTT
GCTAGGAGGTTGGGGGGGAGGGTTGTCGTGGTTAATGGGTATGTGGCCGGTGCGTCGAATACCAGGGAGATGATC
TCTTCCATCGCTACGGCCGTGGGACTCACCTCTACCTCAACGACGACGACGACAACAAGCCTCCTCGCATCTCTA
ACAACCCCCCTAACCCTACAAATCAACTCCATCGACGCCCCCCCCTCCGAAAACCCTCCTCCCAAGCCCTCCTCG
CCCGCCTAGCGACCCACCCCCGCATCCGGCTCATCACCTCGGCCGACACGCCCGACTTCCCACTACTATGGGACG
TAGGCCTCCGATCGGCCTTCAACTTCATCTTCCACGACGCCACGACGTACGCGCCGCTGGACGTGGAGATGGACG
CGGTCGACGTGGTCAACCGCCTGCTCGGGAGGTCCGCTGCCCGGCTCCACGCGAGGGAGGGCGTGGCTTTCGTGC
TGCGCAGCTTGCCGGAGAATGCCAAGAGCCTGTTTCGTCTTCTCGTCGGCGAGGTGTTGGTCGCCATGGAGGAGG
GCGATGAGGTTGCGGCGGTGGAGTATCGGATTGTTTACAACAAGGCGGTTGAGGAGTTTGTCTGCTCTTCTGAGA
TGGCGTTTCGTACCTTGCTCAAAGAGTTGGTTCTTCCCTTTTTACTTTTTTTTTTTTTTTTTTTTTTTCTGTCGG
GTTGGCTGACGTTGGTTGATGCAGGTTTCACGATCATCAGATCATCACCAGTCGCAAGGACGTCGTCGGCACTGA
ACTCTTGAGCGTGCCCTTTCCTCGCGATGAGTTGGAAGCTATGCTGGAGGACATGATGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail