Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06757
Gene name
Locationscaffold_08:983160..984667
Strand+
Gene length (bp)1507
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 1.3E-148 32 408

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0904 0.0627 0.6388 0.4483 0.1514 0.0233 0.4478 0.3546 0.3754 0.0053

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999752

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH76 1.3E-107 29 408

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|851
Ophiocordyceps australis 1348a (Ghana) OphauG2|5443
Ophiocordyceps australis 1348a (Ghana) OphauG2|4774
Ophiocordyceps australis 1348a (Ghana) OphauG2|4766
Ophiocordyceps australis 1348a (Ghana) OphauG2|1899
Ophiocordyceps australis map64 (Brazil) OphauB2|7760
Ophiocordyceps australis map64 (Brazil) OphauB2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|3901
Ophiocordyceps australis map64 (Brazil) OphauB2|3420
Ophiocordyceps australis map64 (Brazil) OphauB2|2008
Ophiocordyceps camponoti-floridani Ophcf2|00987
Ophiocordyceps camponoti-floridani Ophcf2|06598
Ophiocordyceps camponoti-floridani Ophcf2|06757 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06881
Ophiocordyceps camponoti-floridani Ophcf2|03911
Ophiocordyceps camponoti-floridani Ophcf2|02543
Ophiocordyceps camponoti-rufipedis Ophun1|305
Ophiocordyceps camponoti-rufipedis Ophun1|3601
Ophiocordyceps camponoti-rufipedis Ophun1|4119
Ophiocordyceps camponoti-rufipedis Ophun1|5000
Ophiocordyceps camponoti-rufipedis Ophun1|6482
Ophiocordyceps camponoti-rufipedis Ophun1|5419
Ophiocordyceps kimflemingae Ophio5|3601
Ophiocordyceps kimflemingae Ophio5|3900
Ophiocordyceps kimflemingae Ophio5|5653
Ophiocordyceps kimflemingae Ophio5|7279
Ophiocordyceps kimflemingae Ophio5|8067
Ophiocordyceps kimflemingae Ophio5|971
Ophiocordyceps subramaniannii Hirsu2|9651
Ophiocordyceps subramaniannii Hirsu2|923
Ophiocordyceps subramaniannii Hirsu2|6764
Ophiocordyceps subramaniannii Hirsu2|3862
Ophiocordyceps subramaniannii Hirsu2|3585
Ophiocordyceps subramaniannii Hirsu2|266
Ophiocordyceps subramaniannii Hirsu2|2507
Ophiocordyceps subramaniannii Hirsu2|10632

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06757
MRGLTAVLAVAAAALLSWNVQAIEVNVDDEASLKRAAGTAAFGLMKYYSGNNTGDTPGNLPSPYFWWTAGAMFGT
IIDYWFLTGDSSYNDATIQAIVHQGADTRDFMPKNQTRTEGNDDQGFWAMTAMTAAENKFPDPPAEKPQYLALVQ
AVFNQYVQRWDVDDCGGGLRWQIFSFNNGFNYKNSISNGCFFNIAARLARYTGNSTYADWANKIFEWEQQVGLIS
PEFDVFDGITIEADKQCRGLNKDQWSYNAGIYLEGAAAMSDVTKNETWKIRRDGLLRESLTRFSKDQVLFEQFCE
PSRRCNNDQQSFKGFMARWLASTIKLAPETTDSIMPVLRATAQAAAASCAGSTAPGPPPAGFNGQPGTACGFGWE
QKNFDGITGVPPQMNAVAALIYPLAQKAKAPVTVKAGGTSKGDPNAGSQQKDPTALKPITAGDKAGAGFLTLFMV
AGSLGFSTFLVL*
Coding >Ophcf2|06757
ATGAGAGGCCTCACAGCCGTCTTGGCCGTTGCTGCTGCTGCTCTGCTGAGCTGGAATGTGCAGGCCATCGAGGTC
AATGTCGACGATGAGGCTTCGCTTAAGAGAGCTGCTGGTACCGCTGCCTTTGGCCTGATGAAGTATTACAGCGGG
AACAACACCGGGGACACGCCGGGGAACCTACCGTCTCCCTACTTCTGGTGGACGGCCGGAGCCATGTTCGGGACC
ATCATCGACTATTGGTTCCTGACGGGTGACTCGTCGTACAACGACGCGACGATACAGGCCATCGTTCATCAGGGG
GCTGATACCAGGGATTTCATGCCCAAGAACCAGACTCGGACCGAAGGAAACGACGATCAGGGCTTCTGGGCCATG
ACGGCCATGACGGCGGCAGAGAACAAGTTCCCGGACCCGCCGGCCGAGAAGCCGCAATACCTGGCTCTCGTCCAG
GCCGTGTTCAACCAGTACGTCCAGCGGTGGGATGTTGATGACTGCGGTGGCGGACTGCGGTGGCAGATCTTTTCC
TTCAACAACGGCTTCAACTATAAAAACTCCATCTCGAACGGCTGCTTCTTCAATATCGCTGCCCGGTTGGCACGT
TACACGGGTAACTCGACCTATGCCGACTGGGCCAATAAGATCTTTGAGTGGGAGCAGCAGGTCGGACTTATAAGC
CCCGAGTTTGACGTCTTTGACGGCATCACCATCGAGGCCGATAAGCAGTGCCGCGGCCTGAACAAGGATCAGTGG
TCGTACAATGCTGGCATCTATCTCGAAGGGGCGGCCGCCATGTCCGACGTGACCAAGAACGAGACGTGGAAGATA
CGCCGAGACGGCCTCTTACGGGAATCTCTCACCCGCTTCTCCAAGGACCAGGTGCTATTCGAGCAGTTCTGCGAG
CCTTCGAGACGCTGCAACAACGATCAGCAGAGCTTCAAGGGTTTCATGGCTCGCTGGCTCGCCTCGACGATCAAG
CTAGCGCCCGAGACGACAGATAGCATCATGCCGGTCCTCCGAGCCACCGCCCAGGCGGCCGCCGCATCGTGCGCA
GGATCGACGGCGCCCGGTCCGCCGCCCGCCGGCTTCAACGGACAGCCCGGAACGGCTTGCGGCTTCGGCTGGGAG
CAGAAGAATTTCGATGGTATCACGGGCGTGCCGCCTCAGATGAATGCCGTTGCCGCTTTGATCTACCCGCTTGCT
CAGAAGGCCAAGGCCCCGGTGACGGTCAAGGCTGGCGGTACGTCCAAGGGGGATCCTAACGCTGGATCGCAGCAG
AAGGATCCGACTGCCTTGAAGCCCATCACTGCTGGTGACAAGGCTGGGGCTGGTTTTCTCACCTTGTTTATGGTG
GCGGGGAGTTTGGGCTTCAGCACCTTTCTGGTCCTGTAG
Transcript >Ophcf2|06757
ATGAGAGGCCTCACAGCCGTCTTGGCCGTTGCTGCTGCTGCTCTGCTGAGCTGGAATGTGCAGGCCATCGAGGTC
AATGTCGACGATGAGGCTTCGCTTAAGAGAGCTGCTGGTACCGCTGCCTTTGGCCTGATGAAGTATTACAGCGGG
AACAACACCGGGGACACGCCGGGGAACCTACCGTCTCCCTACTTCTGGTGGACGGCCGGAGCCATGTTCGGGACC
ATCATCGACTATTGGTTCCTGACGGGTGACTCGTCGTACAACGACGCGACGATACAGGCCATCGTTCATCAGGGG
GCTGATACCAGGGATTTCATGCCCAAGAACCAGACTCGGACCGAAGGAAACGACGATCAGGGCTTCTGGGCCATG
ACGGCCATGACGGCGGCAGAGAACAAGTTCCCGGACCCGCCGGCCGAGAAGCCGCAATACCTGGCTCTCGTCCAG
GCCGTGTTCAACCAGTACGTCCAGCGGTGGGATGTTGATGACTGCGGTGGCGGACTGCGGTGGCAGATCTTTTCC
TTCAACAACGGCTTCAACTATAAAAACTCCATCTCGAACGGCTGCTTCTTCAATATCGCTGCCCGGTTGGCACGT
TACACGGGTAACTCGACCTATGCCGACTGGGCCAATAAGATCTTTGAGTGGGAGCAGCAGGTCGGACTTATAAGC
CCCGAGTTTGACGTCTTTGACGGCATCACCATCGAGGCCGATAAGCAGTGCCGCGGCCTGAACAAGGATCAGTGG
TCGTACAATGCTGGCATCTATCTCGAAGGGGCGGCCGCCATGTCCGACGTGACCAAGAACGAGACGTGGAAGATA
CGCCGAGACGGCCTCTTACGGGAATCTCTCACCCGCTTCTCCAAGGACCAGGTGCTATTCGAGCAGTTCTGCGAG
CCTTCGAGACGCTGCAACAACGATCAGCAGAGCTTCAAGGGTTTCATGGCTCGCTGGCTCGCCTCGACGATCAAG
CTAGCGCCCGAGACGACAGATAGCATCATGCCGGTCCTCCGAGCCACCGCCCAGGCGGCCGCCGCATCGTGCGCA
GGATCGACGGCGCCCGGTCCGCCGCCCGCCGGCTTCAACGGACAGCCCGGAACGGCTTGCGGCTTCGGCTGGGAG
CAGAAGAATTTCGATGGTATCACGGGCGTGCCGCCTCAGATGAATGCCGTTGCCGCTTTGATCTACCCGCTTGCT
CAGAAGGCCAAGGCCCCGGTGACGGTCAAGGCTGGCGGTACGTCCAAGGGGGATCCTAACGCTGGATCGCAGCAG
AAGGATCCGACTGCCTTGAAGCCCATCACTGCTGGTGACAAGGCTGGGGCTGGTTTTCTCACCTTGTTTATGGTG
GCGGGGAGTTTGGGCTTCAGCACCTTTCTGGTCCTGTAG
Gene >Ophcf2|06757
ATGAGAGGCCTCACAGCCGTCTTGGCCGTTGCTGCTGCTGCTCTGCTGAGCTGGAATGTGCAGGCCATCGAGGTC
AATGTCGACGATGAGGGTACGTTTTGAGAGTTTGTGTCTGAAGTTTGGGGGGGGGGGGTCCGTTGCTGATGGTTT
GCAGCTTCGCTTAAGAGAGCTGCTGGTACCGCTGCCTTTGGCCTGATGAAGTATTACAGCGGGAACAACACCGGG
GACACGCCGGGGAACCTACCGTCTCCCTACTTCTGTGAGTCTCCGGTCTTGTCCTCTTTTGCTTCGGCTGGCTGA
CGAGAGAAAACAAGGGTGGACGGCCGGAGCCATGTTCGGGACCATCATCGACTATTGGTTCCTGACGGGTGACTC
GTCGTACAACGACGCGACGATACAGGCCATCGTTCATCAGGGGGCTGATACCAGGGATTTCATGCCCAAGAACCA
GACTCGGACCGAAGGAAACGACGATCAGGGCTTCTGGGCCATGACGGCCATGACGGCGGCAGAGAACAAGTTCCC
GGACCCGCCGGCCGAGAAGCCGCAATACCTGGCTCTCGTCCAGGCCGTGTTCAACCAGTACGTCCAGCGGTGGGA
TGTTGATGACTGCGGTGGCGGACTGCGGTGGCAGATCTTTTCCTTCAACAACGGCTTCAACTATAAAAACTCCAT
CTCGAACGGCTGCTTCTTCAATATCGCTGCCCGGTTGGCACGTTACACGGGTAACTCGACCTATGCCGACTGGGC
CAATAAGATCTTTGAGTGGGAGCAGCAGGTCGGACTTATAAGCCCCGAGTTTGACGTCTTTGACGGCATCACCAT
CGAGGCCGATAAGCAGTGCCGCGGCCTGAACAAGGATCAGTGGTCGTACAATGCTGGCATCTATCTCGAAGGGGC
GGCCGCCATGTCCGACGTGACCAAGAACGAGACGTGGAAGATACGCCGAGACGGCCTCTTACGGGAATCTCTCAC
CCGCTTCTCCAAGGACCAGGTGCTATTCGAGCAGTTCTGCGAGCCTTCGAGACGCTGCAACAACGATCAGCAGAG
CTTCAAGGGTTTCATGGCTCGCTGGCTCGCCTCGACGATCAAGCTAGCGCCCGAGACGACAGATAGCATCATGCC
GGTCCTCCGAGCCACCGCCCAGGCGGCCGCCGCATCGTGCGCAGGATCGACGGCGCCCGGTCCGCCGCCCGCCGG
CTTCAACGGACAGCCCGGAACGGCTTGCGGCTTCGGCTGGGAGCAGAAGAATTTCGATGGTATCACGGGCGTGCC
GCCTCAGATGAATGCCGTTGCCGCTTTGATCTACCCGCTTGCTCAGAAGGCCAAGGCCCCGGTGACGGTCAAGGC
TGGCGGTACGTCCAAGGGGGATCCTAACGCTGGATCGCAGCAGAAGGATCCGACTGCCTTGAAGCCCATCACTGC
TGGTGACAAGGCTGGGGCTGGTTTTCTCACCTTGTTTATGGTGGCGGGGAGTTTGGGCTTCAGCACCTTTCTGGT
CCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail