Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06746
Gene name
Locationscaffold_08:937779..939645
Strand-
Gene length (bp)1866
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01112 Asparaginase_2 Asparaginase 6.0E-27 39 197
PF01112 Asparaginase_2 Asparaginase 5.6E-13 364 483

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.571 0.5202 0.1633 0.0373 0.3936 0.0321 0.0923 0.0486 0.0503 0.1027

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4418
Ophiocordyceps australis map64 (Brazil) OphauB2|1177
Ophiocordyceps camponoti-floridani Ophcf2|06746 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2582
Ophiocordyceps kimflemingae Ophio5|5523
Ophiocordyceps subramaniannii Hirsu2|8124

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06746
MSPRSHDAASDPMMGRNQCGADGVLDRVLRLSQRQTSVPAIFIHAGAGFHSRQNETIHLRACVSAAEMGMRFLKA
GATSTEAVEAALRILEDKEITNAGYGSNLSMDGTVECDATIVDHLGRSGACGAVPNIRNPISLAKLILDTSNLPL
SLRRVPPNALVGEGARAFAEEHGMTTFANEYLVSTNSRDRFYRWQEDLLRAEGGGKDAAGLGPHLTPSKAATCIP
CQYDTAPAIDALKSFPREHAAAILTGTWNEGQTDSPFAGTPAVESTNMPESALFPPTSAMTFAAAARSSLQIPSP
QRPMAKDKSRVVTKANNDLFAQEIRRKVSNAEEERKQYRGPPTHVEAGEAASSGNLGPEAMTPRRPKRPAETTMP
DGVPLGPGPKRVSYWNVDKDDVVTDTIGAIAIDGRGHIAAGSSSGGIGMKHRGRLGPAAIVGVGTAVVPCAVEDE
EGLTVAAVTSGTGEHMATTMASQKCADRIYQGTRRGPHGLDIADDDENAIMESFIAHDFMEHPGVKHCHASGAIG
VMVVKKHHTGYFLYFAHNTDSFALASMGGLDKKPHCTMSRLPEGCKIANGGRKIRIA*
Coding >Ophcf2|06746
ATGAGCCCCCGCAGCCACGATGCCGCCTCTGATCCCATGATGGGTCGGAACCAGTGTGGCGCTGACGGCGTCCTC
GATCGCGTACTTCGCCTCAGTCAGAGGCAAACATCTGTGCCTGCCATATTCATTCACGCCGGTGCAGGCTTCCAT
AGCCGTCAGAACGAGACTATTCATCTCAGAGCTTGCGTCTCGGCGGCAGAGATGGGCATGCGCTTCCTCAAGGCC
GGTGCTACCTCGACCGAGGCCGTCGAAGCCGCTCTTCGAATACTAGAGGATAAGGAAATCACAAATGCCGGCTAT
GGCTCCAACCTTTCCATGGACGGCACCGTCGAGTGTGACGCCACCATCGTTGACCATCTGGGCCGCAGCGGAGCG
TGCGGAGCTGTCCCCAATATCCGAAACCCAATCTCTCTCGCCAAGCTCATTCTCGACACCAGCAACTTACCCCTG
AGCCTCCGCCGCGTGCCCCCAAACGCCCTGGTGGGAGAAGGCGCCAGGGCATTCGCCGAGGAGCACGGAATGACG
ACGTTTGCCAACGAATATCTCGTCTCCACCAACTCTCGTGATCGTTTCTATCGCTGGCAGGAGGATCTACTGAGA
GCCGAAGGGGGGGGCAAGGACGCAGCCGGTCTCGGCCCTCATCTGACGCCTTCGAAAGCGGCGACGTGTATTCCT
TGCCAGTACGACACGGCTCCGGCCATCGATGCTCTCAAGTCTTTTCCTCGCGAGCATGCGGCTGCCATCCTGACG
GGCACGTGGAACGAAGGCCAGACGGACTCTCCTTTTGCCGGCACGCCGGCGGTTGAATCGACAAACATGCCCGAA
TCGGCCTTGTTCCCACCGACTTCGGCCATGACGTTTGCCGCTGCTGCACGCTCATCGCTGCAGATTCCTTCACCC
CAGCGTCCCATGGCCAAGGATAAGTCAAGAGTCGTGACCAAAGCCAACAACGACCTGTTCGCGCAGGAGATTAGA
CGAAAGGTATCCAACGCAGAAGAGGAGCGCAAACAGTACCGAGGTCCGCCTACCCATGTCGAGGCAGGCGAGGCG
GCGTCGTCGGGCAACTTGGGTCCCGAAGCCATGACTCCGCGCCGCCCTAAGCGGCCGGCCGAGACGACGATGCCG
GACGGTGTCCCGCTTGGCCCCGGTCCCAAGCGCGTGTCGTACTGGAACGTCGACAAAGACGACGTGGTGACGGAC
ACTATCGGCGCCATCGCCATCGACGGCCGCGGCCACATCGCTGCGGGCTCCTCGTCGGGAGGCATCGGCATGAAG
CATCGGGGCAGACTGGGTCCGGCCGCCATCGTCGGAGTCGGAACCGCCGTCGTCCCCTGCGCCGTCGAGGACGAA
GAGGGACTCACGGTGGCGGCTGTGACGAGCGGAACAGGAGAACACATGGCGACGACCATGGCTTCGCAAAAGTGC
GCCGATCGCATCTATCAGGGGACGCGTCGCGGGCCCCATGGCCTCGACATTGCCGACGACGACGAGAATGCCATT
ATGGAATCCTTCATCGCGCACGACTTCATGGAGCATCCGGGCGTCAAGCACTGCCACGCCTCGGGCGCCATCGGC
GTCATGGTGGTCAAGAAGCATCACACGGGCTACTTTCTCTACTTTGCCCACAACACGGATTCCTTCGCCCTCGCC
TCCATGGGCGGTCTCGACAAGAAACCTCACTGCACCATGTCTCGACTGCCCGAGGGCTGTAAGATTGCCAACGGC
GGCCGCAAGATTCGAATCGCTTGA
Transcript >Ophcf2|06746
ATGAGCCCCCGCAGCCACGATGCCGCCTCTGATCCCATGATGGGTCGGAACCAGTGTGGCGCTGACGGCGTCCTC
GATCGCGTACTTCGCCTCAGTCAGAGGCAAACATCTGTGCCTGCCATATTCATTCACGCCGGTGCAGGCTTCCAT
AGCCGTCAGAACGAGACTATTCATCTCAGAGCTTGCGTCTCGGCGGCAGAGATGGGCATGCGCTTCCTCAAGGCC
GGTGCTACCTCGACCGAGGCCGTCGAAGCCGCTCTTCGAATACTAGAGGATAAGGAAATCACAAATGCCGGCTAT
GGCTCCAACCTTTCCATGGACGGCACCGTCGAGTGTGACGCCACCATCGTTGACCATCTGGGCCGCAGCGGAGCG
TGCGGAGCTGTCCCCAATATCCGAAACCCAATCTCTCTCGCCAAGCTCATTCTCGACACCAGCAACTTACCCCTG
AGCCTCCGCCGCGTGCCCCCAAACGCCCTGGTGGGAGAAGGCGCCAGGGCATTCGCCGAGGAGCACGGAATGACG
ACGTTTGCCAACGAATATCTCGTCTCCACCAACTCTCGTGATCGTTTCTATCGCTGGCAGGAGGATCTACTGAGA
GCCGAAGGGGGGGGCAAGGACGCAGCCGGTCTCGGCCCTCATCTGACGCCTTCGAAAGCGGCGACGTGTATTCCT
TGCCAGTACGACACGGCTCCGGCCATCGATGCTCTCAAGTCTTTTCCTCGCGAGCATGCGGCTGCCATCCTGACG
GGCACGTGGAACGAAGGCCAGACGGACTCTCCTTTTGCCGGCACGCCGGCGGTTGAATCGACAAACATGCCCGAA
TCGGCCTTGTTCCCACCGACTTCGGCCATGACGTTTGCCGCTGCTGCACGCTCATCGCTGCAGATTCCTTCACCC
CAGCGTCCCATGGCCAAGGATAAGTCAAGAGTCGTGACCAAAGCCAACAACGACCTGTTCGCGCAGGAGATTAGA
CGAAAGGTATCCAACGCAGAAGAGGAGCGCAAACAGTACCGAGGTCCGCCTACCCATGTCGAGGCAGGCGAGGCG
GCGTCGTCGGGCAACTTGGGTCCCGAAGCCATGACTCCGCGCCGCCCTAAGCGGCCGGCCGAGACGACGATGCCG
GACGGTGTCCCGCTTGGCCCCGGTCCCAAGCGCGTGTCGTACTGGAACGTCGACAAAGACGACGTGGTGACGGAC
ACTATCGGCGCCATCGCCATCGACGGCCGCGGCCACATCGCTGCGGGCTCCTCGTCGGGAGGCATCGGCATGAAG
CATCGGGGCAGACTGGGTCCGGCCGCCATCGTCGGAGTCGGAACCGCCGTCGTCCCCTGCGCCGTCGAGGACGAA
GAGGGACTCACGGTGGCGGCTGTGACGAGCGGAACAGGAGAACACATGGCGACGACCATGGCTTCGCAAAAGTGC
GCCGATCGCATCTATCAGGGGACGCGTCGCGGGCCCCATGGCCTCGACATTGCCGACGACGACGAGAATGCCATT
ATGGAATCCTTCATCGCGCACGACTTCATGGAGCATCCGGGCGTCAAGCACTGCCACGCCTCGGGCGCCATCGGC
GTCATGGTGGTCAAGAAGCATCACACGGGCTACTTTCTCTACTTTGCCCACAACACGGATTCCTTCGCCCTCGCC
TCCATGGGCGGTCTCGACAAGAAACCTCACTGCACCATGTCTCGACTGCCCGAGGGCTGTAAGATTGCCAACGGC
GGCCGCAAGATTCGAATCGCTTGA
Gene >Ophcf2|06746
ATGAGCCCCCGCAGCCACGATGCCGCCTCTGATCCCATGATGGGTCGGAACCAGTGTGGCGCTGACGGCGTCCTC
GATCGCGTACTTCGCCTCAGTCAGAGGCAAACATCTGTGCCTGCCATATTCATTCACGCCGGTGCAGGCTTCCAT
AGCCGTCAGAACGAGACTATTCATCTCAGAGCTTGCGTCTCGTCAGCCTCGCCCCCCCCCCCCCCCCATAGCCAG
TCCCTCGATGACGCTGACTCGACGTACAACAGGGCGGCAGAGATGGGCATGCGCTTCCTCAAGGCCGGTGCTACC
TCGACCGAGGCCGTCGAAGCCGCTCTTCGAATACTAGAGGATAAGGAAATCACAAATGCCGGCTATGGCTCCAAC
CTTTCCATGGACGGCACCGTCGAGTGTGACGCCACCATCGTTGACCATCTGGGCCGCAGCGGAGCGTGCGGAGCT
GTCCCCAGTCAGACGTGTTTCCGGTCGTGACGCCCCGTGGCATGGCTGACGGTGACAGATATCCGAAACCCAATC
TCTCTCGCCAAGCTCATTCTCGACACCAGCAACTTACCCCTGAGCCTCCGCCGCGTGCCCCCAAACGCCCTGGTG
GGAGAAGGCGCCAGGGCATTCGCCGAGGAGCACGGAATGACGACGTTTGCCAACGAATATCTCGTCTCCACCAAC
TCTCGTGATCGTTTCTATCGCTGGCAGGAGGATCTACTGAGAGCCGAAGGGGGGGGCAAGGACGCAGCCGGTCTC
GGCCCTCATCTGACGCCTTCGAAAGCGGCGACGTGTATTCCTTGCCAGTACGACACGGCTCCGGCCATCGATGCT
CTCAAGTCTTTTCCTCGCGAGCATGCGGCTGCCATCCTGACGGGCACGTGGAACGAAGGCCAGACGGACTCTCCT
TTTGCCGGCACGCCGGCGGTTGAATCGACAAACATGCCCGAATCGGCCTTGTTCCCACCGACTTCGGCCATGACG
TTTGCCGCTGCTGCACGCTCATCGCTGCAGATTCCTTCACCCCAGCGTCCCATGGCCAAGGATAAGTCAAGAGTC
GTGACCAAAGCCAACAACGACCTGTTCGCGCAGGAGATTAGACGAAAGGTATCCAACGCAGAAGAGGAGCGCAAA
CAGTACCGAGGTCCGCCTACCCATGTCGAGGCAGGCGAGGCGGCGTCGTCGGGCAACTTGGGTCCCGAAGCCATG
ACTCCGCGCCGCCCTAAGCGGCCGGCCGAGACGACGATGCCGGACGGTGTCCCGCTTGGCCCCGGTCCCAAGCGC
GTGTCGTACTGGAACGTCGACAAAGACGACGTGGTGACGGACACTATCGGCGCCATCGCCATCGACGGCCGCGGC
CACATCGCTGCGGGCTCCTCGTCGGGAGGCATCGGCATGAAGCATCGGGGCAGACTGGGTCCGGCCGCCATCGTC
GGAGTCGGAACCGCCGTCGTCCCCTGCGCCGTCGAGGACGAAGAGGGACTCACGGTGGCGGCTGTGACGAGCGGA
ACAGGAGAACACATGGCGACGACCATGGCTTCGCAAAAGTGCGCCGATCGCATCTATCAGGGGACGCGTCGCGGG
CCCCATGGCCTCGACATTGCCGACGACGACGAGAATGCCATTATGGAATCCTTCATCGCGCACGACTTCATGGAG
CATCCGGGCGTCAAGCACTGCCACGCCTCGGGCGCCATCGGCGTCATGGTGGTCAAGAAGCATCACACGGGCTAC
TTTCTCTACTTTGCCCACAACACGGATTCCTTCGCCCTCGCCTCCATGGGCGGTCTCGACAAGAAACCTCACTGC
ACCATGTCTCGACTGCCCGAGGGCTGTAAGATTGCCAACGGCGGCCGCAAGATTCGAATCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail