Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06740
Gene name
Locationscaffold_08:925569..927454
Strand-
Gene length (bp)1885
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 2.5E-162 53 558

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2029 0.0721 0.7219 0.0668 0.1802 0.0387 0.3216 0.2965 0.0906 0.046

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.980487

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup194
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3230
Ophiocordyceps australis 1348a (Ghana) OphauG2|6609
Ophiocordyceps australis map64 (Brazil) OphauB2|1642
Ophiocordyceps australis map64 (Brazil) OphauB2|3863
Ophiocordyceps camponoti-floridani Ophcf2|02409
Ophiocordyceps camponoti-floridani Ophcf2|06740 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2588
Ophiocordyceps camponoti-rufipedis Ophun1|858
Ophiocordyceps kimflemingae Ophio5|6050
Ophiocordyceps kimflemingae Ophio5|914
Ophiocordyceps subramaniannii Hirsu2|7282
Ophiocordyceps subramaniannii Hirsu2|9336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06740
MVLSMRRLTGLIAVATSLCHGSPVSVVLGPTVRPGARGAVASEASECTSIGRDLLAQGGNAADAVVGTTFCVGIV
APYHSGIGGGGFALVRDADGRYEAVDFRETAPAAAYQDMYRGNVAGSLTGGLAVAVPGEVRGLEYMHSKYGSLPW
ETVLEGAIGVARDGFRVSNDLAARMTTSKQPFLQKDPSFALDFAPNGTLLREGDLMTRKRYAATLERIAREGSAA
FYRGELAEAMIKLVQASNGTMTVEDLERYTVVSRPVQRLRYRGLDLFSVGAPASGAVGLGILKVAEQFAPVEDDA
GLESHRFVEAMRFGYGARARLADPDFVPGVDALEGRLLNEEHALQVRKRIDDDHTLAVADYDPTVNEYVPNSHGT
SHVVTADASGMAVSLTTTINLIFGAQLMEPLSGIVLNNEMNDFSIPGIPNDFGFPPSVANYIAPGKRPLSSITPV
IAAHANGSLLAVVGASGGSRIISATASTLWHLVDHGDSMAGALRRPRMHDQLMPNVLLLEYAFDNRTAAALAAKG
HDISRVGEGLSAVQAIRRLADGSFEAAAEPRQRNSRGFVV*
Coding >Ophcf2|06740
ATGGTCTTGTCCATGCGCCGGCTGACAGGCCTCATCGCCGTCGCCACCTCCCTCTGCCATGGCTCTCCAGTCTCT
GTCGTCCTCGGCCCGACGGTGAGACCAGGCGCGAGAGGTGCTGTGGCCAGTGAGGCTTCGGAGTGCACATCGATC
GGCAGGGACTTGCTTGCTCAAGGCGGTAACGCGGCTGACGCCGTCGTCGGCACTACCTTTTGCGTCGGCATCGTC
GCTCCGTATCATTCGGGCATCGGCGGTGGAGGTTTCGCTCTGGTCCGCGACGCCGACGGTCGATATGAGGCTGTC
GACTTCAGGGAGACGGCTCCGGCGGCTGCCTACCAGGACATGTACCGCGGAAACGTCGCCGGAAGCTTGACAGGT
GGACTCGCCGTCGCGGTCCCCGGCGAGGTCCGCGGTCTGGAGTACATGCATAGCAAATACGGCTCGCTGCCATGG
GAGACGGTGCTGGAGGGCGCCATCGGTGTCGCTCGTGACGGCTTCCGCGTCTCCAACGATCTGGCAGCTAGGATG
ACGACCTCCAAGCAGCCCTTTCTGCAAAAGGATCCCAGCTTCGCTCTCGACTTTGCGCCAAACGGCACTCTCCTC
CGTGAGGGAGACCTCATGACGCGGAAGCGCTACGCTGCCACGCTCGAGCGCATTGCCAGAGAAGGCTCAGCGGCC
TTCTACCGCGGCGAGCTCGCCGAGGCCATGATCAAGCTCGTCCAGGCGTCCAACGGAACCATGACGGTCGAAGAC
CTCGAACGATACACCGTCGTCTCGCGCCCCGTCCAGCGTCTCCGCTACCGAGGGCTGGATCTCTTCTCCGTCGGC
GCCCCGGCCAGCGGCGCCGTCGGGCTCGGCATCCTCAAGGTCGCGGAACAGTTTGCGCCCGTCGAGGACGATGCT
GGTCTCGAGTCCCATCGTTTCGTCGAGGCGATGCGCTTCGGCTACGGAGCACGAGCCAGGCTCGCCGACCCGGAC
TTTGTGCCTGGCGTTGACGCGCTCGAGGGTCGGTTGCTGAATGAGGAACATGCGCTTCAGGTGAGGAAGCGCATC
GATGATGATCACACATTAGCTGTTGCAGACTACGATCCAACTGTCAATGAGTATGTGCCTAACAGCCACGGAACG
TCTCATGTCGTCACCGCCGATGCGTCTGGCATGGCCGTCTCTCTCACCACTACCATCAACCTCATCTTCGGCGCA
CAACTCATGGAACCCCTGAGCGGCATCGTGCTAAACAACGAGATGAACGACTTCTCCATCCCCGGCATCCCCAAC
GACTTCGGCTTCCCGCCCTCAGTGGCAAACTACATCGCGCCGGGCAAACGCCCCCTATCATCCATAACGCCCGTC
ATAGCCGCCCACGCAAACGGCTCTCTTCTCGCCGTAGTCGGCGCATCAGGAGGCTCGCGCATCATCTCCGCCACG
GCCTCCACACTCTGGCACCTGGTCGACCACGGCGACTCCATGGCCGGCGCCCTCCGTCGCCCGCGCATGCACGAT
CAACTCATGCCCAACGTGCTACTGCTAGAATACGCCTTTGATAACCGGACGGCTGCCGCGCTGGCGGCTAAGGGC
CACGACATCTCCCGTGTTGGCGAGGGGCTTAGCGCTGTGCAGGCCATTCGCAGGCTGGCTGATGGCTCTTTCGAG
GCGGCGGCTGAGCCGAGGCAGAGGAACAGTCGGGGCTTTGTCGTGTAG
Transcript >Ophcf2|06740
ATGGTCTTGTCCATGCGCCGGCTGACAGGCCTCATCGCCGTCGCCACCTCCCTCTGCCATGGCTCTCCAGTCTCT
GTCGTCCTCGGCCCGACGGTGAGACCAGGCGCGAGAGGTGCTGTGGCCAGTGAGGCTTCGGAGTGCACATCGATC
GGCAGGGACTTGCTTGCTCAAGGCGGTAACGCGGCTGACGCCGTCGTCGGCACTACCTTTTGCGTCGGCATCGTC
GCTCCGTATCATTCGGGCATCGGCGGTGGAGGTTTCGCTCTGGTCCGCGACGCCGACGGTCGATATGAGGCTGTC
GACTTCAGGGAGACGGCTCCGGCGGCTGCCTACCAGGACATGTACCGCGGAAACGTCGCCGGAAGCTTGACAGGT
GGACTCGCCGTCGCGGTCCCCGGCGAGGTCCGCGGTCTGGAGTACATGCATAGCAAATACGGCTCGCTGCCATGG
GAGACGGTGCTGGAGGGCGCCATCGGTGTCGCTCGTGACGGCTTCCGCGTCTCCAACGATCTGGCAGCTAGGATG
ACGACCTCCAAGCAGCCCTTTCTGCAAAAGGATCCCAGCTTCGCTCTCGACTTTGCGCCAAACGGCACTCTCCTC
CGTGAGGGAGACCTCATGACGCGGAAGCGCTACGCTGCCACGCTCGAGCGCATTGCCAGAGAAGGCTCAGCGGCC
TTCTACCGCGGCGAGCTCGCCGAGGCCATGATCAAGCTCGTCCAGGCGTCCAACGGAACCATGACGGTCGAAGAC
CTCGAACGATACACCGTCGTCTCGCGCCCCGTCCAGCGTCTCCGCTACCGAGGGCTGGATCTCTTCTCCGTCGGC
GCCCCGGCCAGCGGCGCCGTCGGGCTCGGCATCCTCAAGGTCGCGGAACAGTTTGCGCCCGTCGAGGACGATGCT
GGTCTCGAGTCCCATCGTTTCGTCGAGGCGATGCGCTTCGGCTACGGAGCACGAGCCAGGCTCGCCGACCCGGAC
TTTGTGCCTGGCGTTGACGCGCTCGAGGGTCGGTTGCTGAATGAGGAACATGCGCTTCAGGTGAGGAAGCGCATC
GATGATGATCACACATTAGCTGTTGCAGACTACGATCCAACTGTCAATGAGTATGTGCCTAACAGCCACGGAACG
TCTCATGTCGTCACCGCCGATGCGTCTGGCATGGCCGTCTCTCTCACCACTACCATCAACCTCATCTTCGGCGCA
CAACTCATGGAACCCCTGAGCGGCATCGTGCTAAACAACGAGATGAACGACTTCTCCATCCCCGGCATCCCCAAC
GACTTCGGCTTCCCGCCCTCAGTGGCAAACTACATCGCGCCGGGCAAACGCCCCCTATCATCCATAACGCCCGTC
ATAGCCGCCCACGCAAACGGCTCTCTTCTCGCCGTAGTCGGCGCATCAGGAGGCTCGCGCATCATCTCCGCCACG
GCCTCCACACTCTGGCACCTGGTCGACCACGGCGACTCCATGGCCGGCGCCCTCCGTCGCCCGCGCATGCACGAT
CAACTCATGCCCAACGTGCTACTGCTAGAATACGCCTTTGATAACCGGACGGCTGCCGCGCTGGCGGCTAAGGGC
CACGACATCTCCCGTGTTGGCGAGGGGCTTAGCGCTGTGCAGGCCATTCGCAGGCTGGCTGATGGCTCTTTCGAG
GCGGCGGCTGAGCCGAGGCAGAGGAACAGTCGGGGCTTTGTCGTGTAG
Gene >Ophcf2|06740
ATGGGTACGCACGAATATTTGTGACGCCATTACGAACACATCCCTAAGTTCTGACTGCTCATTCTTAGTCTTGTC
CATGCGCCGGCTGACAGGCCTCATCGCCGTCGCCACCTCCCTCTGCCATGGCTCTCCAGTCTCTGTCGTCCTCGG
CCCGACGGTGAGACCAGGCGCGAGAGGTGCTGTGGCCAGTGAGGCTTCGGAGTGCACATCGATCGGCAGGGACTT
GCTTGCTCAAGGCGTACGTTTCCTCCCTTTTGTGTCGCGTTTGTCCTTATATTGAAAGAAAGCCTCTGTGTAGGG
TAACGCGGCTGACGCCGTCGTCGGCACTACCTTTTGCGTCGGCATCGTCGCTCCGTATCATTCGGGCATCGGCGG
TGGAGGTTTCGCTCTGGTCCGCGACGCCGACGGTCGATATGAGGCTGTCGACTTCAGGGAGACGGCTCCGGCGGC
TGCCTACCAGGACATGTACCGCGGAAACGTCGCCGGAAGCTTGACAGGTGGACTCGCCGTCGCGGTCCCCGGCGA
GGTCCGCGGTCTGGAGTACATGCATAGCAAATACGGCTCGCTGCCATGGGAGACGGTGCTGGAGGGCGCCATCGG
TGTCGCTCGTGACGGCTTCCGCGTCTCCAACGATCTGGCAGCTAGGATGACGACCTCCAAGCAGCCCTTTCTGCA
AAAGGATCCCAGCTTCGCTCTCGACTTTGCGCCAAACGGCACTCTCCTCCGTGAGGGAGACCTCATGACGCGGAA
GCGCTACGCTGCCACGCTCGAGCGCATTGCCAGAGAAGGCTCAGCGGCCTTCTACCGCGGCGAGCTCGCCGAGGC
CATGATCAAGCTCGTCCAGGCGTCCAACGGAACCATGACGGTCGAAGACCTCGAACGATACACCGTCGTCTCGCG
CCCCGTCCAGCGTCTCCGCTACCGAGGGCTGGATCTCTTCTCCGTCGGCGCCCCGGCCAGCGGCGCCGTCGGGCT
CGGCATCCTCAAGGTCGCGGAACAGTTTGCGCCCGTCGAGGACGATGCTGGTCTCGAGTCCCATCGTTTCGTCGA
GGCGATGCGCTTCGGCTACGGAGCACGAGCCAGGCTCGCCGACCCGGACTTTGTGCCTGGCGTTGACGCGCTCGA
GGGTCGGTTGCTGAATGAGGAACATGCGCTTCAGGTGAGGAAGCGCATCGATGATGATCACACATTAGCTGTTGC
AGACTACGATCCAACTGTCAATGAGTATGTGCCTAACAGCCACGGAACGTCTCATGTCGTCACCGCCGATGCGTC
TGGCATGGCCGTCTCTCTCACCACTACCATCAACCTCATCTTCGGCGCACAACTCATGGAACCCCTGAGCGGCAT
CGTGCTGTACATACATTAACCCCCCCCCCCCCCCAAAGGATCGTACCTGTTCTGACGTCGAAGCCTCAGAAACAA
CGAGATGAACGACTTCTCCATCCCCGGCATCCCCAACGACTTCGGCTTCCCGCCCTCAGTGGCAAACTACATCGC
GCCGGGCAAACGCCCCCTATCATCCATAACGCCCGTCATAGCCGCCCACGCAAACGGCTCTCTTCTCGCCGTAGT
CGGCGCATCAGGAGGCTCGCGCATCATCTCCGCCACGGCCTCCACACTCTGGCACCTGGTCGACCACGGCGACTC
CATGGCCGGCGCCCTCCGTCGCCCGCGCATGCACGATCAACTCATGCCCAACGTGCTACTGCTAGAATACGCCTT
TGATAACCGGACGGCTGCCGCGCTGGCGGCTAAGGGCCACGACATCTCCCGTGTTGGCGAGGGGCTTAGCGCTGT
GCAGGCCATTCGCAGGCTGGCTGATGGCTCTTTCGAGGCGGCGGCTGAGCCGAGGCAGAGGAACAGTCGGGGCTT
TGTCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail