Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06737
Gene name
Locationscaffold_08:921154..922024
Strand+
Gene length (bp)870
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14523 Syntaxin_2 Syntaxin-like protein 2.1E-23 33 130
PF05739 SNARE SNARE domain 3.9E-14 213 262

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1766 0.1372 0.0574 0.616 0.1013 0.0033 0.2826 0.6736 0.5229 0.0336

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 248 267 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4483
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1605
Ophiocordyceps australis map64 (Brazil) OphauB2|6735
Ophiocordyceps camponoti-floridani Ophcf2|06737 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2591
Ophiocordyceps kimflemingae Ophio5|911
Ophiocordyceps subramaniannii Hirsu2|9339

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06737
MSYEQLSNMESGRRDPGGYSDDPAFRNLQHDLKTKLQSLLSGNRKLANDVNVLGTKKDTPRLRERVHNSMDKARD
LCRDIGDGVKRLQAWDDLSKQQRYEQTKVSSDFQAALQEFQSLQRTALEKEKASVTAARAAHETESGPSDGQDPS
LEQQQQQQQLLSQMAPQDEVDFQEALIIEREEEIRNIEQGVGDLNVLFRQVAQIVDEQEVGIRTIADNVENVHDN
TRQADVETRQAARYQKAARNKSCCLLLILGVILTIVILAIVLG*
Coding >Ophcf2|06737
ATGTCGTACGAGCAGCTATCCAACATGGAGTCGGGTCGACGCGATCCCGGCGGCTACAGCGACGATCCCGCGTTC
CGCAATCTCCAGCACGATCTCAAGACCAAGCTGCAGTCGCTGCTGAGCGGTAATCGCAAGCTTGCCAACGATGTC
AACGTCCTGGGCACCAAGAAAGACACGCCGCGTCTGCGCGAGCGCGTCCATAATAGTATGGACAAGGCTCGCGAT
CTATGCAGAGATATCGGCGACGGCGTCAAGCGGCTGCAGGCATGGGACGATCTATCGAAGCAACAGCGATACGAA
CAAACCAAGGTTTCTAGCGACTTTCAAGCAGCCCTTCAAGAGTTTCAGAGCCTGCAGAGGACAGCCCTCGAGAAG
GAAAAGGCGTCCGTCACTGCGGCCCGTGCCGCTCACGAGACGGAGTCAGGCCCCTCGGACGGCCAGGACCCCTCG
CTAGAGCAGCAGCAGCAGCAGCAGCAGCTACTGTCGCAGATGGCACCACAGGACGAGGTCGACTTCCAGGAGGCC
CTCATCATCGAGCGCGAGGAGGAGATTCGCAATATCGAGCAGGGCGTAGGCGACCTCAACGTCTTGTTCCGTCAG
GTTGCACAGATTGTCGACGAGCAAGAGGTCGGCATCCGGACCATAGCGGACAATGTAGAAAACGTTCACGATAAT
ACGCGACAGGCGGACGTTGAGACGCGACAAGCCGCGCGGTACCAAAAGGCCGCGCGAAACAAAAGCTGTTGTCTG
CTTCTCATTCTGGGCGTCATTCTCACCATTGTCATTTTAGCCATCGTTCTGGGTTGA
Transcript >Ophcf2|06737
ATGTCGTACGAGCAGCTATCCAACATGGAGTCGGGTCGACGCGATCCCGGCGGCTACAGCGACGATCCCGCGTTC
CGCAATCTCCAGCACGATCTCAAGACCAAGCTGCAGTCGCTGCTGAGCGGTAATCGCAAGCTTGCCAACGATGTC
AACGTCCTGGGCACCAAGAAAGACACGCCGCGTCTGCGCGAGCGCGTCCATAATAGTATGGACAAGGCTCGCGAT
CTATGCAGAGATATCGGCGACGGCGTCAAGCGGCTGCAGGCATGGGACGATCTATCGAAGCAACAGCGATACGAA
CAAACCAAGGTTTCTAGCGACTTTCAAGCAGCCCTTCAAGAGTTTCAGAGCCTGCAGAGGACAGCCCTCGAGAAG
GAAAAGGCGTCCGTCACTGCGGCCCGTGCCGCTCACGAGACGGAGTCAGGCCCCTCGGACGGCCAGGACCCCTCG
CTAGAGCAGCAGCAGCAGCAGCAGCAGCTACTGTCGCAGATGGCACCACAGGACGAGGTCGACTTCCAGGAGGCC
CTCATCATCGAGCGCGAGGAGGAGATTCGCAATATCGAGCAGGGCGTAGGCGACCTCAACGTCTTGTTCCGTCAG
GTTGCACAGATTGTCGACGAGCAAGAGGTCGGCATCCGGACCATAGCGGACAATGTAGAAAACGTTCACGATAAT
ACGCGACAGGCGGACGTTGAGACGCGACAAGCCGCGCGGTACCAAAAGGCCGCGCGAAACAAAAGCTGTTGTCTG
CTTCTCATTCTGGGCGTCATTCTCACCATTGTCATTTTAGCCATCGTTCTGGGTTGA
Gene >Ophcf2|06737
ATGTCGTACGAGCAGCTATCCAACATGGAGTCGGGTCGACGCGATCCCGGCGGCTACAGCGACGATCCCGCGTTC
CGCAATCTCCAGCACGATCTCAAGACCAAGCTGCAGTCGCTGCTGAGCGGTAATCGCAAGCTTGCCAACGATGTC
AACGTCCTGGGCACCAAGAAAGACACGCCGCGTCTGCGCGAGCGCGTCCATAATAGTATGGACAAGGCTCGCGAT
CTATGCAGAGATATCGGCGACGGCGTCAAGCGGCTGCAGGCATGGGACGATCTATCGGTCGGTTCCTCCATGATG
CTCGCTGTTCCGCGCTTCTTATTGCTGTTGCTGACTGGATAGCAGAAGCAACAGCGATACGAACAAACCAAGGTT
TCTAGCGACTTTCAAGCAGCCCTTCAAGAGTTTCAGAGCCTGCAGAGGACAGCCCTCGAGAAGGAAAAGGCGTCC
GTCACTGCGGCCCGTGCCGCTCACGAGACGGAGTCAGGCCCCTCGGACGGCCAGGACCCCTCGCTAGAGCAGCAG
CAGCAGCAGCAGCAGCTACTGTCGCAGATGGCACCACAGGACGAGGTCGACTTCCAGGAGGCCCTCATCATCGAG
CGCGAGGAGGAGATTCGCAATATCGAGCAGGGCGTAGGCGACCTCAACGTCTTGTTCCGTCAGGTTGCACAGATT
GTCGACGAGCAAGAGGTCGGCATCCGGACCATAGCGGACAATGTAGAAAACGTTCACGATAATACGCGACAGGCG
GACGTTGAGACGCGACAAGCCGCGCGGTACCAAAAGGCCGCGCGAAACAAAAGCTGTTGTCTGCTTCTCATTCTG
GGCGTCATTCTCACCATTGTCATTTTAGCCATCGTTCTGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail