Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06730
Gene name
Locationscaffold_08:898723..899637
Strand+
Gene length (bp)914
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 9.6E-65 10 170
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 4.6E-35 10 124
PF00025 Arf ADP-ribosylation factor family 2.7E-16 9 139
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-04 11 108

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole|Golgi apparatus 0.3843 0.1349 0.0263 0.4549 0.119 0.0015 0.2881 0.6521 0.6886 0.0435

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup211
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1614
Ophiocordyceps australis 1348a (Ghana) OphauG2|7926
Ophiocordyceps australis map64 (Brazil) OphauB2|5863
Ophiocordyceps australis map64 (Brazil) OphauB2|6743
Ophiocordyceps camponoti-floridani Ophcf2|02840
Ophiocordyceps camponoti-floridani Ophcf2|06730 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6533
Ophiocordyceps kimflemingae Ophio5|5354
Ophiocordyceps kimflemingae Ophio5|902
Ophiocordyceps subramaniannii Hirsu2|1577
Ophiocordyceps subramaniannii Hirsu2|6246

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06730
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTVKLQIWDTAGQERFRTITS
SYYRGAHGICVVYDVTDMDSFDNVKQWLQEIDRYATEGVNKLLVGNKSDIADKKVVEYTVAKELADSLDIPFLET
SAKNASNVEQAFLTMARQIKERMGTTTANNTKPSVQVGQGQGVGSSSSGGCC*
Coding >Ophcf2|06730
ATGAACCCTGAATACGATTACCTGTTCAAGCTGCTTCTCATCGGTGACTCCGGTGTCGGCAAGTCTTGCCTGTTG
CTCCGCTTCGCCGACGATACCTATACCGAGTCGTACATCTCCACCATCGGCGTCGACTTTAAAATCCGCACGATA
GAGCTCGATGGCAAGACGGTCAAGTTGCAAATCTGGGATACCGCCGGTCAGGAACGTTTCCGCACCATCACCTCG
TCGTACTACCGCGGCGCTCATGGCATCTGCGTCGTCTACGACGTCACCGACATGGACTCGTTCGACAACGTCAAG
CAATGGCTCCAGGAGATCGACCGTTACGCCACCGAGGGCGTCAACAAGCTGCTCGTCGGGAACAAGAGCGATATC
GCCGACAAAAAAGTAGTCGAATACACCGTCGCAAAGGAACTCGCCGACTCCCTTGACATCCCCTTCCTCGAGACG
TCAGCCAAGAACGCGAGCAACGTCGAGCAAGCCTTCCTGACCATGGCCCGTCAGATCAAGGAGCGCATGGGCACA
ACTACAGCCAACAACACCAAGCCCAGCGTCCAAGTCGGCCAGGGACAAGGCGTCGGTTCCTCTTCCAGCGGCGGC
TGCTGCTAA
Transcript >Ophcf2|06730
ATGAACCCTGAATACGATTACCTGTTCAAGCTGCTTCTCATCGGTGACTCCGGTGTCGGCAAGTCTTGCCTGTTG
CTCCGCTTCGCCGACGATACCTATACCGAGTCGTACATCTCCACCATCGGCGTCGACTTTAAAATCCGCACGATA
GAGCTCGATGGCAAGACGGTCAAGTTGCAAATCTGGGATACCGCCGGTCAGGAACGTTTCCGCACCATCACCTCG
TCGTACTACCGCGGCGCTCATGGCATCTGCGTCGTCTACGACGTCACCGACATGGACTCGTTCGACAACGTCAAG
CAATGGCTCCAGGAGATCGACCGTTACGCCACCGAGGGCGTCAACAAGCTGCTCGTCGGGAACAAGAGCGATATC
GCCGACAAAAAAGTAGTCGAATACACCGTCGCAAAGGAACTCGCCGACTCCCTTGACATCCCCTTCCTCGAGACG
TCAGCCAAGAACGCGAGCAACGTCGAGCAAGCCTTCCTGACCATGGCCCGTCAGATCAAGGAGCGCATGGGCACA
ACTACAGCCAACAACACCAAGCCCAGCGTCCAAGTCGGCCAGGGACAAGGCGTCGGTTCCTCTTCCAGCGGCGGC
TGCTGCTAA
Gene >Ophcf2|06730
ATGAACCCTGAGTGGTGCGCGACAAACCCCGTGATGCCACTACCTTGGCTTGCTTGCTGACTTTTGCTGGACAGA
GTCTTTGGCTTTGGTCTTGACGTGGTGCTTTGCTGCCTCTGACGCATGATTCTTGCAGATACGATTACCTGTTCA
AGCTGCTTCTCATCGGTGACTCCGGTGTCGGCAAGTCTTGCCTGTTGCTCCGCTTCGCCGACGATACCTATACCG
AGTCGTACATCTCCACCATCGGCGTCGACTTTGTATGTCGTCACATTGCGTCCTCGGATGCATTCTCCAGCTGAC
GATGTGGTGCAGAAAATCCGCACGATAGAGCTCGATGGCAAGACGGTCAAGTTGCAAATCGTCCGTCTCTCCCGT
CTGCACCCCATCCAGCTTCTGACCTCATTTCTTTCTTCTTCTTTGTAGTGGGATACCGCCGGTCAGGAACGTTTC
CGCACCATCACCTCGTCGTACTACCGCGGCGCTCATGGCATCTGCGTCGTCTACGACGTCACCGACATGGACTCG
TTCGACAACGTCAAGCAATGGCTCCAGGAGATCGACCGTTACGCCACCGAGGGCGTCAACAAGCTGCTCGTCGGG
AACAAGAGCGATATCGCCGACAAAAAAGTAGTCGAATACACCGTCGCAAAGGTGCGCTCTCGTCATCCCCTCACT
GCCAAGCAGCCAACCTGTAACAACTGACACCGTCCTCGCAGGAACTCGCCGACTCCCTTGACATCCCCTTCCTCG
AGACGTCAGCCAAGAACGCGAGCAACGTCGAGCAAGCCTTCCTGACCATGGCCCGTCAGATCAAGGAGCGCATGG
GCACAACTACAGCCAACAACACCAAGCCCAGCGTCCAAGTCGGCCAGGGACAAGGCGTCGGTTCCTCTTCCAGCG
GCGGCTGCTGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail