Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06726
Gene name
Locationscaffold_08:890296..891858
Strand-
Gene length (bp)1562
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04377 ATE_C Arginine-tRNA-protein transferase, C terminus 1.7E-42 176 312
PF04376 ATE_N Arginine-tRNA-protein transferase, N terminus 2.7E-24 28 104

GO

GO Term Description Terminal node
GO:0004057 arginyltransferase activity Yes
GO:0016598 protein arginylation Yes
GO:0043170 macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0043412 macromolecule modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016755 aminoacyltransferase activity No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Lysosome/Vacuole 0.7001 0.7205 0.1 0.0491 0.121 0.0949 0.1385 0.5651 0.1591 0.1643

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3355
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1618
Ophiocordyceps australis map64 (Brazil) OphauB2|6747
Ophiocordyceps camponoti-floridani Ophcf2|06726 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|467
Ophiocordyceps kimflemingae Ophio5|898
Ophiocordyceps subramaniannii Hirsu2|6241

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06726
MDAFGSRGLGNSATDYELIAPIGYANSSRCGYCSGKASSSSTNRFSYYARATSMSPAFYQTLINRCWRRSGKLLY
RPNPRHACCPHYTLRLDANQFRPSRDQRQAVNRFNRYILGDSYVKEAARLFPRSKAETKRRNNEFRLVERLHEAE
YDGLGKPPEPAHKFTVTLEDNTFTEEKYLVYENYQRVVHKEDEKQIGRRSFERFLCASPLRRGTVIDPDGRRRRL
GSYHQCYRVDGVLVAIGVLDLLPDSVSSVYFFYHEMMHEHTPGKLGAMFEISLALEEGYRWWYSGFYIHSCPKMR
YKMDFSPQYILDPVALTWDVLDETVLRLLDQKPFVSLSLERQAAASGDDAMDTADRGFNASPTMDQMRDDGGEDE
DRLPLLESDMPAIPSVAEMERVDLDHVGIVFNEAAGPIFRTGQTSRWHAESVRDWPSFRAAVAELAAALGPDLVG
SFCVDLTRG*
Coding >Ophcf2|06726
ATGGATGCGTTTGGCTCGCGCGGCCTCGGGAACTCCGCCACCGACTATGAACTGATAGCGCCCATCGGTTATGCC
AACTCTTCGAGATGCGGCTACTGCTCTGGGAAGGCGTCATCTTCTTCGACGAATCGCTTTTCTTACTACGCAAGA
GCAACTTCCATGAGCCCCGCCTTTTACCAAACACTAATCAATCGCTGTTGGAGACGTTCCGGGAAGCTCCTGTAT
CGACCGAATCCGCGCCACGCCTGCTGTCCTCACTACACGCTTCGACTAGACGCGAACCAGTTCAGGCCCTCGAGG
GACCAGCGGCAGGCCGTCAACCGTTTCAACAGATATATCCTCGGCGACTCATACGTCAAGGAAGCTGCTCGGCTG
TTTCCGCGCTCCAAGGCAGAAACCAAGAGGCGAAACAACGAGTTTCGACTCGTTGAGCGCCTTCACGAAGCCGAG
TACGACGGCCTCGGAAAACCACCGGAGCCCGCTCATAAGTTTACCGTCACCCTCGAAGACAACACATTCACCGAG
GAAAAGTACCTGGTATACGAAAACTACCAACGGGTCGTCCATAAAGAAGATGAAAAGCAAATAGGTCGACGCTCA
TTCGAGCGCTTTCTTTGTGCCTCGCCGCTAAGACGTGGAACTGTTATCGATCCGGATGGGCGCAGGCGTCGGCTG
GGCTCGTACCATCAATGCTACCGTGTCGATGGCGTTCTGGTCGCAATCGGTGTCTTGGATCTCCTTCCGGACAGT
GTAAGCTCCGTCTACTTTTTCTATCACGAGATGATGCATGAGCACACGCCCGGCAAGCTAGGCGCCATGTTCGAG
ATTTCTCTGGCCTTGGAAGAGGGATACCGCTGGTGGTACTCGGGCTTCTACATCCACAGCTGCCCCAAGATGAGA
TACAAGATGGACTTTTCGCCGCAGTACATACTCGATCCCGTGGCCCTGACTTGGGATGTGCTGGACGAGACTGTT
TTGAGGCTTCTTGATCAGAAGCCATTCGTCAGCCTATCTCTGGAAAGACAGGCTGCGGCCAGCGGCGATGACGCC
ATGGATACGGCAGACAGGGGCTTCAACGCCAGCCCCACCATGGATCAGATGAGAGATGATGGTGGCGAAGACGAG
GACCGGCTGCCTCTGTTGGAATCCGACATGCCGGCAATACCCTCGGTGGCAGAGATGGAAAGGGTCGACCTGGAC
CACGTAGGCATCGTCTTCAACGAAGCGGCGGGACCCATCTTCCGGACGGGTCAGACGTCGAGATGGCACGCAGAG
TCGGTGAGGGACTGGCCGTCTTTCCGAGCTGCAGTCGCGGAACTGGCGGCCGCTCTGGGGCCAGACCTGGTGGGC
TCGTTTTGCGTCGACTTGACGCGGGGGTGA
Transcript >Ophcf2|06726
ATGGATGCGTTTGGCTCGCGCGGCCTCGGGAACTCCGCCACCGACTATGAACTGATAGCGCCCATCGGTTATGCC
AACTCTTCGAGATGCGGCTACTGCTCTGGGAAGGCGTCATCTTCTTCGACGAATCGCTTTTCTTACTACGCAAGA
GCAACTTCCATGAGCCCCGCCTTTTACCAAACACTAATCAATCGCTGTTGGAGACGTTCCGGGAAGCTCCTGTAT
CGACCGAATCCGCGCCACGCCTGCTGTCCTCACTACACGCTTCGACTAGACGCGAACCAGTTCAGGCCCTCGAGG
GACCAGCGGCAGGCCGTCAACCGTTTCAACAGATATATCCTCGGCGACTCATACGTCAAGGAAGCTGCTCGGCTG
TTTCCGCGCTCCAAGGCAGAAACCAAGAGGCGAAACAACGAGTTTCGACTCGTTGAGCGCCTTCACGAAGCCGAG
TACGACGGCCTCGGAAAACCACCGGAGCCCGCTCATAAGTTTACCGTCACCCTCGAAGACAACACATTCACCGAG
GAAAAGTACCTGGTATACGAAAACTACCAACGGGTCGTCCATAAAGAAGATGAAAAGCAAATAGGTCGACGCTCA
TTCGAGCGCTTTCTTTGTGCCTCGCCGCTAAGACGTGGAACTGTTATCGATCCGGATGGGCGCAGGCGTCGGCTG
GGCTCGTACCATCAATGCTACCGTGTCGATGGCGTTCTGGTCGCAATCGGTGTCTTGGATCTCCTTCCGGACAGT
GTAAGCTCCGTCTACTTTTTCTATCACGAGATGATGCATGAGCACACGCCCGGCAAGCTAGGCGCCATGTTCGAG
ATTTCTCTGGCCTTGGAAGAGGGATACCGCTGGTGGTACTCGGGCTTCTACATCCACAGCTGCCCCAAGATGAGA
TACAAGATGGACTTTTCGCCGCAGTACATACTCGATCCCGTGGCCCTGACTTGGGATGTGCTGGACGAGACTGTT
TTGAGGCTTCTTGATCAGAAGCCATTCGTCAGCCTATCTCTGGAAAGACAGGCTGCGGCCAGCGGCGATGACGCC
ATGGATACGGCAGACAGGGGCTTCAACGCCAGCCCCACCATGGATCAGATGAGAGATGATGGTGGCGAAGACGAG
GACCGGCTGCCTCTGTTGGAATCCGACATGCCGGCAATACCCTCGGTGGCAGAGATGGAAAGGGTCGACCTGGAC
CACGTAGGCATCGTCTTCAACGAAGCGGCGGGACCCATCTTCCGGACGGGTCAGACGTCGAGATGGCACGCAGAG
TCGGTGAGGGACTGGCCGTCTTTCCGAGCTGCAGTCGCGGAACTGGCGGCCGCTCTGGGGCCAGACCTGGTGGGC
TCGTTTTGCGTCGACTTGACGCGGGGGTGA
Gene >Ophcf2|06726
ATGGATGCGTTTGGCTCGCGCGGCCTCGGGAACTCCGCCACCGACTATGAACTGATAGCGCCCATCGGTGAGTTG
AGAAATTCCCCTGTGATTCATCTTGTATAAAACCCGTGTCTCTCGCCGGGGGCCAATTGCTCATTCTCTAAATAG
GTTATGCCAACTCTTCGAGATGCGGCTACTGCTCTGGGAAGGCGTCATCTTCTTCGACGAATCGTAAGTGTCGCT
CGGCTTTCAACACCCTCACGGGGTTCAGTCCATCGTGAACAGGTCCTCGTCCCCGCCGAGGCTGAACGAAGCTCA
ACGAGCTTCCAGGCTTTTCTTACTACGCAAGAGCAACTTCCATGAGCCCCGCCTTTTACCAAACACTAATCAATC
GCTGTTGGAGACGTTCCGGGAAGCTCCTGTATCGACCGAATCCGCGCCACGCCTGCTGTCCTCACTACACGCTTC
GACTAGACGCGAACCAGTTCAGGCCCTCGAGGGACCAGCGGCAGGCCGTCAACCGTTTCAACAGATATATCCTCG
GCGACTCATACGTCAAGGAAGCTGCTCGGCTGTTTCCGCGCTCCAAGGCAGAAACCAAGAGGCGAAACAACGAGT
TTCGACTCGTTGAGCGCCTTCACGAAGCCGAGTACGACGGCCTCGGAAAACCACCGGAGCCCGCTCATAAGTTTA
CCGTCACCCTCGAAGACAACACATTCACCGAGGAAAAGTACCTGGTATACGAAAACTACCAACGGGTCGTCCATA
AAGAAGATGAAAAGCAAATAGGTCGACGCTCATTCGAGCGCTTTCTTTGTGCCTCGCCGCTAAGACGTGGAACTG
TTATCGATCCGGATGGGCGCAGGCGTCGGCTGGGCTCGTACCATCAATGCTACCGTGTCGATGGCGTTCTGGTCG
CAATCGGTGTCTTGGATCTCCTTCCGGACAGTGTAAGCTCCGTCTACTTTTTCTATCACGAGATGATGCATGAGC
ACACGCCCGGCAAGCTAGGCGCCATGTTCGAGATTTCTCTGGCCTTGGAAGAGGGATACCGCTGGTGGTACTCGG
GCTTCTACATCCACAGCTGCCCCAAGATGAGATACAAGATGGACTTTTCGCCGCAGTACATACTCGATCCCGTGG
CCCTGACTTGGGATGTGCTGGACGAGACTGTTTTGAGGCTTCTTGATCAGAAGCCATTCGTCAGCCTATCTCTGG
AAAGACAGGCTGCGGCCAGCGGCGATGACGCCATGGATACGGCAGACAGGGGCTTCAACGCCAGCCCCACCATGG
ATCAGATGAGAGATGATGGTGGCGAAGACGAGGACCGGCTGCCTCTGTTGGAATCCGACATGCCGGCAATACCCT
CGGTGGCAGAGATGGAAAGGGTCGACCTGGACCACGTAGGCATCGTCTTCAACGAAGCGGCGGGACCCATCTTCC
GGACGGGTCAGACGTCGAGATGGCACGCAGAGTCGGTGAGGGACTGGCCGTCTTTCCGAGCTGCAGTCGCGGAAC
TGGCGGCCGCTCTGGGGCCAGACCTGGTGGGCTCGTTTTGCGTCGACTTGACGCGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail