Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06723
Gene name
Locationscaffold_08:886725..887172
Strand-
Gene length (bp)447
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00034 Cytochrom_C Cytochrome c 2.3E-12 8 104
PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III 8.6E-08 7 102

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0009055 electron transfer activity Yes
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2906 0.1553 0.5559 0.2497 0.7115 0.1595 0.0148 0.2062 0.1077 0.0315

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup919
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1621
Ophiocordyceps australis map64 (Brazil) OphauB2|6750
Ophiocordyceps camponoti-floridani Ophcf2|06723 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|464
Ophiocordyceps kimflemingae Ophio5|130
Ophiocordyceps subramaniannii Hirsu2|6238

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06723
MAGGGDSKKGAGLFKTRCAQCHTVEKGGGNKIGPALHGLFGRKTGSVEGYSYTDANKQADVTWDDKTLFAYLENP
KKYIPGTKMAFGGLKKEKDRNDLIAYLKESTA*
Coding >Ophcf2|06723
ATGGCTGGTGGTGGCGATAGCAAGAAAGGCGCCGGCCTCTTCAAGACGCGCTGCGCCCAGTGCCACACCGTCGAA
AAGGGCGGCGGCAACAAGATCGGCCCTGCCCTGCACGGCCTCTTCGGCCGCAAGACGGGCTCCGTCGAGGGATAC
TCGTACACCGATGCCAACAAGCAGGCCGACGTCACCTGGGACGACAAGACGCTGTTCGCCTACCTCGAGAACCCC
AAGAAGTACATTCCCGGCACCAAGATGGCCTTTGGAGGCCTCAAGAAGGAGAAGGACCGCAATGACTTGATCGCC
TACCTCAAGGAGTCGACAGCTTAA
Transcript >Ophcf2|06723
ATGGCTGGTGGTGGCGATAGCAAGAAAGGCGCCGGCCTCTTCAAGACGCGCTGCGCCCAGTGCCACACCGTCGAA
AAGGGCGGCGGCAACAAGATCGGCCCTGCCCTGCACGGCCTCTTCGGCCGCAAGACGGGCTCCGTCGAGGGATAC
TCGTACACCGATGCCAACAAGCAGGCCGACGTCACCTGGGACGACAAGACGCTGTTCGCCTACCTCGAGAACCCC
AAGAAGTACATTCCCGGCACCAAGATGGCCTTTGGAGGCCTCAAGAAGGAGAAGGACCGCAATGACTTGATCGCC
TACCTCAAGGAGTCGACAGCTTAA
Gene >Ophcf2|06723
ATGGCTGGTGGTGGTAAGTTGGCCTCTTGTTTTCTCTTTCGACATCAAGCCCCAACAGCTGACGTCGCCATCCTC
CATCAGGCGATAGCAAGAAAGGCGCCGGCCTCTTCAAGACGCGCTGCGCCCAGTGCCACACCGTCGAAAAGGGCG
GCGGCAACAAGATCGGCCCTGCCCTGCACGGCCTCTTCGGCCGCAAGACGGGCTCCGTCGAGGGATACTCGTACA
CCGATGCCAACAAGCAGGCCGACGTCACCTGGGACGACAAGACGCTGTTCGCCTACCTCGAGAACCCCAAGAAGT
ACATTCCCGGCACCAAGATGGCCTTTGGAGGCCTCAAGAAGGAGAAGGACCGCAATGACTTGATCGCGTCAGTCA
TCTCTTGAAACTTCTTGCAACAACCTGAGCTGACAGTTTGCCCCCAGCTACCTCAAGGAGTCGACAGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail