Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06721
Gene name
Locationscaffold_08:880470..882724
Strand-
Gene length (bp)2254
Transcript length (bp)2064
Coding sequence length (bp)2064
Protein length (aa) 688

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1907 0.1023 0.9315 0.1768 0.1101 0.0598 0.1898 0.134 0.2193 0.0097

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup515
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7433
Ophiocordyceps australis map64 (Brazil) OphauB2|1555
Ophiocordyceps australis map64 (Brazil) OphauB2|595
Ophiocordyceps camponoti-floridani Ophcf2|06721 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07183
Ophiocordyceps camponoti-rufipedis Ophun1|2349
Ophiocordyceps camponoti-rufipedis Ophun1|462
Ophiocordyceps kimflemingae Ophio5|3679
Ophiocordyceps subramaniannii Hirsu2|226

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06721
MRPENWTSLALAVSWTLRYPILGQATVTSKKPPTTEAPEAYRAPAEEPSVLYFMCTLRPGPSWLQAAGGLSPRLP
DPSPDEAWGYATVNGLGSAWAQLWRDWRDRTALDTNWDFESTLYLYEVSTCPNMVSHYSQPELNRVYWALGGFRW
SQVVRYAALNPGDDMDGPSWINNGEFNTDWTSFHTSGWQPELSGYGLDNPIWLDGDWTDRVPAAAMTRREQALLF
VRGIMQNTQLRTLFDWRGDFPLVRVTDSALSVPLSEVGGRSMIESFQLDTLRLPEDVARTLREKGRLTGEVCRVI
SLAISLSVWMHMDHRPHRRAWRQTGVRDGDEEYCQAAKEQNQCISDAEAGDCRALSDAIGQIKAASLSNTRGYGT
GGLPRTACSRLRKIRFILDMADEYGAGTYDEISARVGPSSSFIVADEPHTPSRGDSIQLEPSMKDVFPSETVAVN
EIGRISISARRVNVFGDDWWKIKGVRLVGQCSDSLTTIQLDKFASLNRQVQGGSEWQTRTEVWAGPVWPEDWNVA
NYCTHLERVEVQVQLGSSLAAGTWDDIVVQVGRQELTMMKQPSAGTDSRMRVDLKQAFGTLDGVIPVTRPIKFSV
FSVPDGRAIGDSWKLRGITFRARCQRSDKGYKVDKYAGVNVWRLRDEGKQGHFSGKISLSDWQEESRTAANYHEM
PLSNWLKPRRSR*
Coding >Ophcf2|06721
ATGAGACCCGAAAACTGGACCAGTCTTGCCCTGGCGGTATCATGGACCCTCCGATATCCCATCCTCGGCCAGGCC
ACAGTCACGAGCAAGAAGCCCCCCACGACGGAAGCTCCAGAGGCGTACCGGGCGCCAGCCGAGGAGCCCAGCGTC
CTCTACTTCATGTGCACCCTCCGCCCCGGCCCGAGCTGGCTGCAAGCCGCGGGCGGGCTGTCCCCTCGACTGCCG
GACCCGAGCCCCGACGAGGCATGGGGCTACGCCACCGTGAACGGCTTGGGCAGCGCCTGGGCCCAGCTCTGGAGG
GACTGGAGGGACCGGACGGCGCTCGACACCAACTGGGACTTTGAATCGACCTTGTACCTGTACGAGGTCTCGACG
TGTCCCAACATGGTATCTCATTATAGTCAGCCGGAGCTGAACCGTGTGTACTGGGCCTTGGGCGGCTTCCGGTGG
TCGCAGGTGGTGAGATACGCGGCCTTGAACCCGGGTGACGACATGGATGGCCCGTCCTGGATCAACAATGGCGAG
TTCAACACGGATTGGACGTCGTTCCACACCAGCGGCTGGCAGCCCGAGCTCTCGGGCTACGGCCTCGACAATCCC
ATCTGGCTCGACGGCGACTGGACGGACCGCGTCCCGGCAGCGGCCATGACGCGCCGCGAGCAGGCCCTGCTCTTC
GTCAGGGGCATCATGCAGAACACGCAGCTCAGGACCCTGTTCGACTGGCGCGGCGACTTTCCCCTGGTCCGCGTT
ACAGACTCGGCCTTGTCCGTTCCCCTGTCCGAGGTCGGCGGACGGAGCATGATAGAAAGCTTCCAGCTGGATACG
CTGAGGTTGCCGGAAGACGTGGCGCGGACGCTGAGAGAAAAGGGGAGGTTGACAGGGGAAGTATGCCGCGTCATC
TCTCTGGCCATCAGCCTCTCCGTCTGGATGCACATGGATCACCGGCCTCACCGACGGGCATGGAGACAGACAGGG
GTAAGAGACGGCGATGAGGAGTACTGCCAGGCTGCAAAAGAACAGAACCAGTGCATCTCAGACGCAGAGGCGGGC
GACTGTCGCGCCCTGAGCGATGCCATCGGCCAGATCAAGGCGGCCAGCCTCTCCAACACCCGGGGATATGGCACC
GGGGGCCTGCCCAGGACAGCCTGTAGCCGTCTCAGGAAGATCAGGTTCATCCTGGACATGGCCGACGAGTACGGC
GCGGGGACTTACGACGAGATATCAGCCAGGGTCGGCCCATCGTCGAGCTTCATCGTCGCCGATGAGCCTCATACG
CCGTCGAGGGGAGATTCGATACAGCTGGAGCCGAGTATGAAGGACGTTTTCCCCTCGGAGACGGTGGCCGTCAAT
GAGATTGGACGCATCTCCATCTCTGCCAGGCGCGTCAACGTGTTTGGCGATGACTGGTGGAAGATCAAAGGCGTC
CGTCTTGTCGGTCAATGCAGCGACTCGCTCACGACGATCCAGCTCGACAAGTTCGCGTCCCTCAACCGACAAGTC
CAGGGCGGAAGCGAGTGGCAGACAAGGACCGAGGTCTGGGCCGGCCCCGTCTGGCCCGAGGACTGGAACGTGGCC
AACTACTGCACCCACCTGGAGAGGGTCGAGGTCCAGGTCCAGCTTGGCAGCAGCTTGGCAGCCGGCACGTGGGAC
GACATCGTGGTCCAGGTCGGCCGCCAGGAGCTGACGATGATGAAGCAGCCCTCAGCCGGGACTGACAGCAGAATG
CGAGTCGACCTGAAGCAAGCCTTTGGAACCCTTGACGGCGTCATACCCGTGACGCGGCCCATAAAGTTCTCCGTC
TTCTCTGTGCCCGACGGACGCGCCATCGGAGACTCGTGGAAGTTGAGAGGCATCACTTTTCGAGCCCGATGTCAG
CGGTCTGACAAGGGGTACAAGGTCGACAAATACGCAGGCGTCAACGTGTGGCGGCTGCGTGACGAAGGAAAGCAA
GGCCACTTCAGCGGCAAGATTTCGTTGAGTGACTGGCAGGAGGAGTCGAGGACGGCGGCGAATTACCATGAGATG
CCTCTCAGCAACTGGCTCAAGCCCCGTCGTAGTCGTTAG
Transcript >Ophcf2|06721
ATGAGACCCGAAAACTGGACCAGTCTTGCCCTGGCGGTATCATGGACCCTCCGATATCCCATCCTCGGCCAGGCC
ACAGTCACGAGCAAGAAGCCCCCCACGACGGAAGCTCCAGAGGCGTACCGGGCGCCAGCCGAGGAGCCCAGCGTC
CTCTACTTCATGTGCACCCTCCGCCCCGGCCCGAGCTGGCTGCAAGCCGCGGGCGGGCTGTCCCCTCGACTGCCG
GACCCGAGCCCCGACGAGGCATGGGGCTACGCCACCGTGAACGGCTTGGGCAGCGCCTGGGCCCAGCTCTGGAGG
GACTGGAGGGACCGGACGGCGCTCGACACCAACTGGGACTTTGAATCGACCTTGTACCTGTACGAGGTCTCGACG
TGTCCCAACATGGTATCTCATTATAGTCAGCCGGAGCTGAACCGTGTGTACTGGGCCTTGGGCGGCTTCCGGTGG
TCGCAGGTGGTGAGATACGCGGCCTTGAACCCGGGTGACGACATGGATGGCCCGTCCTGGATCAACAATGGCGAG
TTCAACACGGATTGGACGTCGTTCCACACCAGCGGCTGGCAGCCCGAGCTCTCGGGCTACGGCCTCGACAATCCC
ATCTGGCTCGACGGCGACTGGACGGACCGCGTCCCGGCAGCGGCCATGACGCGCCGCGAGCAGGCCCTGCTCTTC
GTCAGGGGCATCATGCAGAACACGCAGCTCAGGACCCTGTTCGACTGGCGCGGCGACTTTCCCCTGGTCCGCGTT
ACAGACTCGGCCTTGTCCGTTCCCCTGTCCGAGGTCGGCGGACGGAGCATGATAGAAAGCTTCCAGCTGGATACG
CTGAGGTTGCCGGAAGACGTGGCGCGGACGCTGAGAGAAAAGGGGAGGTTGACAGGGGAAGTATGCCGCGTCATC
TCTCTGGCCATCAGCCTCTCCGTCTGGATGCACATGGATCACCGGCCTCACCGACGGGCATGGAGACAGACAGGG
GTAAGAGACGGCGATGAGGAGTACTGCCAGGCTGCAAAAGAACAGAACCAGTGCATCTCAGACGCAGAGGCGGGC
GACTGTCGCGCCCTGAGCGATGCCATCGGCCAGATCAAGGCGGCCAGCCTCTCCAACACCCGGGGATATGGCACC
GGGGGCCTGCCCAGGACAGCCTGTAGCCGTCTCAGGAAGATCAGGTTCATCCTGGACATGGCCGACGAGTACGGC
GCGGGGACTTACGACGAGATATCAGCCAGGGTCGGCCCATCGTCGAGCTTCATCGTCGCCGATGAGCCTCATACG
CCGTCGAGGGGAGATTCGATACAGCTGGAGCCGAGTATGAAGGACGTTTTCCCCTCGGAGACGGTGGCCGTCAAT
GAGATTGGACGCATCTCCATCTCTGCCAGGCGCGTCAACGTGTTTGGCGATGACTGGTGGAAGATCAAAGGCGTC
CGTCTTGTCGGTCAATGCAGCGACTCGCTCACGACGATCCAGCTCGACAAGTTCGCGTCCCTCAACCGACAAGTC
CAGGGCGGAAGCGAGTGGCAGACAAGGACCGAGGTCTGGGCCGGCCCCGTCTGGCCCGAGGACTGGAACGTGGCC
AACTACTGCACCCACCTGGAGAGGGTCGAGGTCCAGGTCCAGCTTGGCAGCAGCTTGGCAGCCGGCACGTGGGAC
GACATCGTGGTCCAGGTCGGCCGCCAGGAGCTGACGATGATGAAGCAGCCCTCAGCCGGGACTGACAGCAGAATG
CGAGTCGACCTGAAGCAAGCCTTTGGAACCCTTGACGGCGTCATACCCGTGACGCGGCCCATAAAGTTCTCCGTC
TTCTCTGTGCCCGACGGACGCGCCATCGGAGACTCGTGGAAGTTGAGAGGCATCACTTTTCGAGCCCGATGTCAG
CGGTCTGACAAGGGGTACAAGGTCGACAAATACGCAGGCGTCAACGTGTGGCGGCTGCGTGACGAAGGAAAGCAA
GGCCACTTCAGCGGCAAGATTTCGTTGAGTGACTGGCAGGAGGAGTCGAGGACGGCGGCGAATTACCATGAGATG
CCTCTCAGCAACTGGCTCAAGCCCCGTCGTAGTCGTTAG
Gene >Ophcf2|06721
ATGAGACCCGAAAACTGGACCAGTCTTGCCCTGGCGGTATCATGGACCCTCCGATATCCCATCCTCGGCCAGGCC
ACAGTCACGAGCAAGAAGCCCCCCACGACGGAAGCTCCAGAGGCGTACCGGGCGCCAGCCGAGGAGCCCAGCGTC
CTCTACTTCATGTGCACCCTCCGCCCCGGCCCGAGCTGGCTGCAAGCCGCGGGCGGGCTGTCCCCTCGACTGCCG
GACCCGAGCCCCGACGAGGCATGGGGCTACGCCACCGTGAACGGCTTGGGCAGCGCCTGGGCCCAGCTCTGGAGG
GACTGGAGGGACCGGACGGCGCTCGACACCAACTGGGACTTTGAATCGACCTTGTACCTGTACGAGGTCTCGACG
TGTCCCAACATGGTATCTCATTATAGTCAGCCGGAGCTGAACCGTGTGTACTGGGCCTTGGGCGGCTTCCGGTGG
TCGCAGGTGGTGAGATACGCGGCCTTGAACCCGGGTGACGACATGGATGGCCCGTCCTGGATCAACAATGGCGAG
TTCAACACGGATTGGACGTCGTTCCACACCAGCGGCTGGCAGCCCGAGCTCTCGGGCTACGGCCTCGACAATCCC
ATCTGGCTCGACGGCGACTGGACGGACCGCGTCCCGGCAGCGGCCATGACGCGCCGCGAGCAGGCCCTGCTCTTC
GTCAGGGGCATCATGCAGAACACGCAGCTCAGGACCCTGTTCGACTGGCGCGGCGACTTTCCCCTGGTCCGCGTT
ACAGACTCGGCCTTGTCCGTTCCCCTGTCCGAGGTCGGCGGACGGAGCATGATAGAAAGCTTCCAGCTGGATACG
CTGAGGTTGCCGGAAGACGTGGCGCGGACGCTGAGAGAAAAGGGGAGGTTGACAGGGGAAGTATGCCGCGTCATC
TCTCTGGCCATCAGCCTCTCCGTCTGGATGCACATGGATCACCGGCCTCACCGACGGGCATGGAGACAGACAGGT
GTGTTGGGAGCGGATGAGACACCAGGATCGGACTAACAGGAGAACAGGGGTAAGAGACGGCGATGAGGAGTACTG
CCAGGCTGCAAAAGAACAGAACCAGTGCATCTCAGACGCAGAGGCGGGCGACTGTCGCGCCCTGAGCGATGCCAT
CGGCCAGATCAAGGCGGCCAGCCTCTCCAACACCCGGGGATATGGCACCGGGGGCCTGCCCAGGACAGCCTGTAG
CCGTCTCAGGAAGATCAGGTTCATCCTGGACATGGCCGACGAGTACGGCGCGGGGACTTACGACGAGATATCAGC
CAGGGTCGGCCCATCGTCGAGCTTCATCGTCGCCGATGAGCCTCATACGCCGTCGAGGGGAGATTCGATACAGCT
GGAGCCGAGTATGAAGGACGTTTTCCCCTCGGAGACGGTGGCCGTCAATGAGATTGGACGCATCTCCATCTCTGC
CAGGCGCGTCAACGTGTTTGGCGATGACTGGTGGAAGATCAAAGGTGAGTTCCCCCCCCTCGGCCGAAGAAGAGA
GGGACGGGAGACAGACGACGGAAGGACAGCTCAACGAGACTCTTGACAGGCGTCCGTCTTGTCGGTCAATGCAGC
GACTCGCTCACGACGATCCAGCTCGACAAGTTCGCGTCCCTCAACCGACAAGTCCAGGGCGGAAGCGAGTGGCAG
ACAAGGACCGAGGTCTGGGCCGGCCCCGTCTGGCCCGAGGACTGGAACGTGGCCAACTACTGCACCCACCTGGAG
AGGGTCGAGGTCCAGGTCCAGCTTGGCAGCAGCTTGGCAGCCGGCACGTGGGACGACATCGTGGTCCAGGTCGGC
CGCCAGGAGCTGACGATGATGAAGCAGCCCTCAGCCGGGACTGACAGCAGAATGCGAGTCGACCTGAAGCAAGCC
TTTGGAACCCTTGACGGCGTCATACCCGTGACGCGGCCCATAAAGTTCTCCGTCTTCTCTGTGCCCGACGGACGC
GCCATCGGAGACTCGTGGAAGTTGAGAGGTGAGCCCACGGCAACGGACACTCGGTCGTCTCAGCCTTCTAACGAG
ATGACTGTATTCAGGCATCACTTTTCGAGCCCGATGTCAGCGGTCTGACAAGGGGTACAAGGTCGACAAATACGC
AGGCGTCAACGTGTGGCGGCTGCGTGACGAAGGAAAGCAAGGCCACTTCAGCGGCAAGATTTCGTTGAGTGACTG
GCAGGAGGAGTCGAGGACGGCGGCGAATTACCATGAGATGCCTCTCAGCAACTGGCTCAAGCCCCGTCGTAGTCG
TTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail