Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06717
Gene name
Locationscaffold_08:873384..874480
Strand+
Gene length (bp)1096
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03881 Fructosamin_kin Fructosamine kinase 8.5E-68 37 314

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.8064 0.8252 0.3098 0.0224 0.235 0.1237 0.1843 0.061 0.0218 0.1082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 109.89 62.91 156.88
Alive In ants, during behavior modification 55.86 29.68 82.03
Dead In ants, recently dead 47.54 24.48 70.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.418682 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup635
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1624
Ophiocordyceps australis map64 (Brazil) OphauB2|6753
Ophiocordyceps camponoti-floridani Ophcf2|06717 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|459
Ophiocordyceps kimflemingae Ophio5|3676
Ophiocordyceps subramaniannii Hirsu2|1032
Ophiocordyceps subramaniannii Hirsu2|6235

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06717
MIDGAIVEALGLDASRSDMVPHGNSAFSSTFKLATVTDGDRRMLFVKTAAGNEAGRMFAGEHASLNAIHDAVPNF
CPKSHAHGALASDPNRFFLVTDFVDLCSEPSTTLSLAAKLARLHTTPAPVPDGHDTPVFGFPVSTFCGDTAQDNG
WKTSWADFYADNRLRAVLRAGVAKHGPDAELADAVEDVAALVVPRLLGQGRLRDPVVPVVVHGDLWNGNHGTGRI
GKGRAVENVVFDPSAAYAHSEYELGIMRMFGGFDSVFWDEYHKLVPKAEPVAEWEHRIMLYELYHHLNHFVIFGG
GYRGGAMSIMKKLTARYGA*
Coding >Ophcf2|06717
ATGATCGACGGCGCCATCGTCGAAGCCCTCGGCCTCGATGCTTCCCGGTCCGACATGGTTCCGCACGGCAACTCA
GCCTTCTCGTCCACCTTTAAGCTGGCGACGGTCACCGACGGGGACCGACGGATGCTCTTCGTCAAGACGGCTGCT
GGCAACGAGGCGGGGCGCATGTTTGCCGGCGAACACGCGTCTCTCAACGCGATCCACGACGCCGTCCCCAACTTC
TGCCCCAAGTCACACGCCCACGGGGCCCTAGCCTCAGACCCGAACCGCTTCTTCCTCGTCACCGACTTCGTCGAC
TTGTGCTCCGAGCCCTCCACGACCCTCTCGCTCGCCGCCAAACTCGCCAGGCTGCACACCACGCCCGCCCCCGTC
CCGGACGGTCACGACACGCCCGTCTTCGGTTTCCCCGTCTCCACCTTTTGCGGCGACACGGCCCAGGATAACGGC
TGGAAGACTTCGTGGGCCGACTTTTATGCCGATAACCGCCTGCGCGCCGTCCTACGTGCCGGCGTCGCCAAACAC
GGTCCGGACGCCGAACTGGCCGATGCCGTCGAAGATGTTGCCGCGCTTGTTGTTCCGCGGCTTCTCGGCCAGGGC
CGCCTCCGCGATCCCGTCGTCCCCGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCACGGGTCGCATT
GGTAAAGGCCGCGCCGTCGAAAATGTCGTCTTCGACCCCTCGGCTGCGTACGCCCACTCCGAGTACGAGCTGGGC
ATTATGCGTATGTTTGGCGGATTCGACTCTGTCTTCTGGGACGAGTATCACAAGCTCGTTCCCAAGGCCGAACCG
GTGGCCGAATGGGAACATCGCATCATGCTATACGAGTTATATCATCATCTGAACCACTTCGTCATCTTCGGCGGC
GGTTATCGCGGCGGCGCCATGTCCATCATGAAGAAGCTCACGGCTAGATATGGCGCTTGA
Transcript >Ophcf2|06717
ATGATCGACGGCGCCATCGTCGAAGCCCTCGGCCTCGATGCTTCCCGGTCCGACATGGTTCCGCACGGCAACTCA
GCCTTCTCGTCCACCTTTAAGCTGGCGACGGTCACCGACGGGGACCGACGGATGCTCTTCGTCAAGACGGCTGCT
GGCAACGAGGCGGGGCGCATGTTTGCCGGCGAACACGCGTCTCTCAACGCGATCCACGACGCCGTCCCCAACTTC
TGCCCCAAGTCACACGCCCACGGGGCCCTAGCCTCAGACCCGAACCGCTTCTTCCTCGTCACCGACTTCGTCGAC
TTGTGCTCCGAGCCCTCCACGACCCTCTCGCTCGCCGCCAAACTCGCCAGGCTGCACACCACGCCCGCCCCCGTC
CCGGACGGTCACGACACGCCCGTCTTCGGTTTCCCCGTCTCCACCTTTTGCGGCGACACGGCCCAGGATAACGGC
TGGAAGACTTCGTGGGCCGACTTTTATGCCGATAACCGCCTGCGCGCCGTCCTACGTGCCGGCGTCGCCAAACAC
GGTCCGGACGCCGAACTGGCCGATGCCGTCGAAGATGTTGCCGCGCTTGTTGTTCCGCGGCTTCTCGGCCAGGGC
CGCCTCCGCGATCCCGTCGTCCCCGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCACGGGTCGCATT
GGTAAAGGCCGCGCCGTCGAAAATGTCGTCTTCGACCCCTCGGCTGCGTACGCCCACTCCGAGTACGAGCTGGGC
ATTATGCGTATGTTTGGCGGATTCGACTCTGTCTTCTGGGACGAGTATCACAAGCTCGTTCCCAAGGCCGAACCG
GTGGCCGAATGGGAACATCGCATCATGCTATACGAGTTATATCATCATCTGAACCACTTCGTCATCTTCGGCGGC
GGTTATCGCGGCGGCGCCATGTCCATCATGAAGAAGCTCACGGCTAGATATGGCGCTTGA
Gene >Ophcf2|06717
ATGATCGACGGCGCCATCGTCGAAGCCCTCGGCCTCGATGCTTCCCGGTCCGACATGGTTCCGCACGGCAACTCA
GCCTTCTCGTCCACCTTTAAGCTGGCGACGGTCACCGACGGGGACCGACGGATGCTCTTCGTCAAGACGGCTGCT
GGCAACGAGGCGGGGCGCATGTTTGCCGGTTCGTTCCCTTCCTCGCATAAGAGCCATGTGATTTATACAGGTTGA
ATGCTTGGGTGTTGACCACCATGACCATGACCACAACAGGCGAACACGCGTCTCTCAACGCGATCCACGACGCCG
TCCCCAACTTCTGCCCCAAGTCACACGCCCACGGGGCCCTAGCCTCAGACCCGAACCGCTTCTTCCTCGTCACCG
ACTTCGTCGACTTGTGCTCCGAGCCCTCCACGACCCTCTCGCTCGCCGCCAAACTCGCCAGGCTGCACACCACGC
CCGCCCCCGTCCCGGACGGTCACGACACGCCCGTCTTCGGTTTCCCCGTCTCCACCTTTTGCGGCGACACGGCCC
AGGATAACGGCTGGAAGACTTCGTGGGCCGACTTTTATGCCGATAACCGCCTGCGCGCCGTCCTACGTGCCGGCG
TCGCCAAACACGGTCCGGACGCCGAACTGGCCGATGCCGTCGAAGATGTTGCCGCGCTTGTTGTTCCGCGGCTTC
TCGGCCAGGGCCGCCTCCGCGATCCCGTCGTCCCCGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCA
CGGGTCGCATTGGTAAAGGCCGCGCCGTCGAAAATGTCGTCTTCGACCCCTCGGCTGCGTACGCCCACTCCGAGT
ACGAGCTGGGCATTATGCGTATGTTTGGCGGATTCGACTCTGTCTTCTGGGACGAGTATCACAAGCTCGTTCCCA
AGGCCGAACCGGTGGCCGAATGGGAACATCGCATCATGCTATACGAGTTGTGAGTCAGAGTCGTCTCTCCTCGAT
TCATCGGCCGTCTGACGCTGATAGATATCATCATCTGAACCACTTCGTCATCTTCGGCGGCGGTTATCGCGGCGG
CGCCATGTCCATCATGAAGAAGCTCACGGCTAGATATGGCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail