Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06717
Gene name
Locationscaffold_08:873384..874480
Strand+
Gene length (bp)1096
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03881 Fructosamin_kin Fructosamine kinase 8.5E-68 37 314

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.8064 0.8252 0.3098 0.0224 0.235 0.1237 0.1843 0.061 0.0218 0.1082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup635
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1624
Ophiocordyceps australis map64 (Brazil) OphauB2|6753
Ophiocordyceps camponoti-floridani Ophcf2|06717 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|459
Ophiocordyceps kimflemingae Ophio5|3676
Ophiocordyceps subramaniannii Hirsu2|1032
Ophiocordyceps subramaniannii Hirsu2|6235

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06717
MIDGAIVEALGLDASRSDMVPHGNSAFSSTFKLATVTDGDRRMLFVKTAAGNEAGRMFAGEHASLNAIHDAVPNF
CPKSHAHGALASDPNRFFLVTDFVDLCSEPSTTLSLAAKLARLHTTPAPVPDGHDTPVFGFPVSTFCGDTAQDNG
WKTSWADFYADNRLRAVLRAGVAKHGPDAELADAVEDVAALVVPRLLGQGRLRDPVVPVVVHGDLWNGNHGTGRI
GKGRAVENVVFDPSAAYAHSEYELGIMRMFGGFDSVFWDEYHKLVPKAEPVAEWEHRIMLYELYHHLNHFVIFGG
GYRGGAMSIMKKLTARYGA*
Coding >Ophcf2|06717
ATGATCGACGGCGCCATCGTCGAAGCCCTCGGCCTCGATGCTTCCCGGTCCGACATGGTTCCGCACGGCAACTCA
GCCTTCTCGTCCACCTTTAAGCTGGCGACGGTCACCGACGGGGACCGACGGATGCTCTTCGTCAAGACGGCTGCT
GGCAACGAGGCGGGGCGCATGTTTGCCGGCGAACACGCGTCTCTCAACGCGATCCACGACGCCGTCCCCAACTTC
TGCCCCAAGTCACACGCCCACGGGGCCCTAGCCTCAGACCCGAACCGCTTCTTCCTCGTCACCGACTTCGTCGAC
TTGTGCTCCGAGCCCTCCACGACCCTCTCGCTCGCCGCCAAACTCGCCAGGCTGCACACCACGCCCGCCCCCGTC
CCGGACGGTCACGACACGCCCGTCTTCGGTTTCCCCGTCTCCACCTTTTGCGGCGACACGGCCCAGGATAACGGC
TGGAAGACTTCGTGGGCCGACTTTTATGCCGATAACCGCCTGCGCGCCGTCCTACGTGCCGGCGTCGCCAAACAC
GGTCCGGACGCCGAACTGGCCGATGCCGTCGAAGATGTTGCCGCGCTTGTTGTTCCGCGGCTTCTCGGCCAGGGC
CGCCTCCGCGATCCCGTCGTCCCCGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCACGGGTCGCATT
GGTAAAGGCCGCGCCGTCGAAAATGTCGTCTTCGACCCCTCGGCTGCGTACGCCCACTCCGAGTACGAGCTGGGC
ATTATGCGTATGTTTGGCGGATTCGACTCTGTCTTCTGGGACGAGTATCACAAGCTCGTTCCCAAGGCCGAACCG
GTGGCCGAATGGGAACATCGCATCATGCTATACGAGTTATATCATCATCTGAACCACTTCGTCATCTTCGGCGGC
GGTTATCGCGGCGGCGCCATGTCCATCATGAAGAAGCTCACGGCTAGATATGGCGCTTGA
Transcript >Ophcf2|06717
ATGATCGACGGCGCCATCGTCGAAGCCCTCGGCCTCGATGCTTCCCGGTCCGACATGGTTCCGCACGGCAACTCA
GCCTTCTCGTCCACCTTTAAGCTGGCGACGGTCACCGACGGGGACCGACGGATGCTCTTCGTCAAGACGGCTGCT
GGCAACGAGGCGGGGCGCATGTTTGCCGGCGAACACGCGTCTCTCAACGCGATCCACGACGCCGTCCCCAACTTC
TGCCCCAAGTCACACGCCCACGGGGCCCTAGCCTCAGACCCGAACCGCTTCTTCCTCGTCACCGACTTCGTCGAC
TTGTGCTCCGAGCCCTCCACGACCCTCTCGCTCGCCGCCAAACTCGCCAGGCTGCACACCACGCCCGCCCCCGTC
CCGGACGGTCACGACACGCCCGTCTTCGGTTTCCCCGTCTCCACCTTTTGCGGCGACACGGCCCAGGATAACGGC
TGGAAGACTTCGTGGGCCGACTTTTATGCCGATAACCGCCTGCGCGCCGTCCTACGTGCCGGCGTCGCCAAACAC
GGTCCGGACGCCGAACTGGCCGATGCCGTCGAAGATGTTGCCGCGCTTGTTGTTCCGCGGCTTCTCGGCCAGGGC
CGCCTCCGCGATCCCGTCGTCCCCGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCACGGGTCGCATT
GGTAAAGGCCGCGCCGTCGAAAATGTCGTCTTCGACCCCTCGGCTGCGTACGCCCACTCCGAGTACGAGCTGGGC
ATTATGCGTATGTTTGGCGGATTCGACTCTGTCTTCTGGGACGAGTATCACAAGCTCGTTCCCAAGGCCGAACCG
GTGGCCGAATGGGAACATCGCATCATGCTATACGAGTTATATCATCATCTGAACCACTTCGTCATCTTCGGCGGC
GGTTATCGCGGCGGCGCCATGTCCATCATGAAGAAGCTCACGGCTAGATATGGCGCTTGA
Gene >Ophcf2|06717
ATGATCGACGGCGCCATCGTCGAAGCCCTCGGCCTCGATGCTTCCCGGTCCGACATGGTTCCGCACGGCAACTCA
GCCTTCTCGTCCACCTTTAAGCTGGCGACGGTCACCGACGGGGACCGACGGATGCTCTTCGTCAAGACGGCTGCT
GGCAACGAGGCGGGGCGCATGTTTGCCGGTTCGTTCCCTTCCTCGCATAAGAGCCATGTGATTTATACAGGTTGA
ATGCTTGGGTGTTGACCACCATGACCATGACCACAACAGGCGAACACGCGTCTCTCAACGCGATCCACGACGCCG
TCCCCAACTTCTGCCCCAAGTCACACGCCCACGGGGCCCTAGCCTCAGACCCGAACCGCTTCTTCCTCGTCACCG
ACTTCGTCGACTTGTGCTCCGAGCCCTCCACGACCCTCTCGCTCGCCGCCAAACTCGCCAGGCTGCACACCACGC
CCGCCCCCGTCCCGGACGGTCACGACACGCCCGTCTTCGGTTTCCCCGTCTCCACCTTTTGCGGCGACACGGCCC
AGGATAACGGCTGGAAGACTTCGTGGGCCGACTTTTATGCCGATAACCGCCTGCGCGCCGTCCTACGTGCCGGCG
TCGCCAAACACGGTCCGGACGCCGAACTGGCCGATGCCGTCGAAGATGTTGCCGCGCTTGTTGTTCCGCGGCTTC
TCGGCCAGGGCCGCCTCCGCGATCCCGTCGTCCCCGTCGTCGTCCACGGCGACCTATGGAACGGCAATCACGGCA
CGGGTCGCATTGGTAAAGGCCGCGCCGTCGAAAATGTCGTCTTCGACCCCTCGGCTGCGTACGCCCACTCCGAGT
ACGAGCTGGGCATTATGCGTATGTTTGGCGGATTCGACTCTGTCTTCTGGGACGAGTATCACAAGCTCGTTCCCA
AGGCCGAACCGGTGGCCGAATGGGAACATCGCATCATGCTATACGAGTTGTGAGTCAGAGTCGTCTCTCCTCGAT
TCATCGGCCGTCTGACGCTGATAGATATCATCATCTGAACCACTTCGTCATCTTCGGCGGCGGTTATCGCGGCGG
CGCCATGTCCATCATGAAGAAGCTCACGGCTAGATATGGCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail