Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06716
Gene name
Locationscaffold_08:870250..871800
Strand+
Gene length (bp)1550
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08442 ATP-grasp_2 ATP-grasp domain 3.8E-78 39 245
PF00549 Ligase_CoA CoA-ligase 1.4E-26 305 425

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1321 0.0886 0.0454 0.1018 0.9454 0.0634 0.0375 0.046 0.1011 0.0351

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup889
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3238
Ophiocordyceps australis map64 (Brazil) OphauB2|6754
Ophiocordyceps camponoti-floridani Ophcf2|06716 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|458
Ophiocordyceps kimflemingae Ophio5|3674
Ophiocordyceps subramaniannii Hirsu2|5540

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06716
MFRFGHSRALASALKASNARVAPSARIPGVAQQRRALSIHEYRSADLLRQYGVGVPKGSVAQSAEEAKAVAKNIG
SEDMVIKAQVLAGGRGKGTFDNGLKGGVRVIYSPHEAEMFAQQMIGHKLVTKQTGAGGRLCNAVYICERKFARRE
FYLAILMDRTSQTPVIVSSSQGGMDIETVAKENPEAIVTTYIDINKGVTDNVARGIATKLGFSDQCVEEAKETIQ
KLYKIFEERDATQIEINPLSETSDHQVLCMDAKFGFDDNADFRQKEVFEWRDTTQEDADEVRAASSGLNFIKLDG
DIGCLVNGAGLAMATMDIIKLNGGQPANFLDVGGGATPAAIKEAFELITSDAKVTAIFVNIFGGIVRCDHIANGL
IKTVETLNLKIPIIARLQGTNVEQAHKLINESGMKIFSIDDLQSAAEKAVQLSKMVKLARDMDVGVEFSLGI*
Coding >Ophcf2|06716
ATGTTCCGCTTCGGCCACAGCCGCGCCCTAGCGTCGGCCTTGAAGGCTTCCAATGCCCGGGTCGCGCCGTCGGCC
CGTATCCCCGGTGTTGCCCAGCAGCGGCGGGCGCTGAGCATCCACGAGTACCGATCCGCTGATCTGCTACGTCAG
TATGGAGTCGGCGTTCCCAAGGGCTCGGTGGCCCAGTCGGCCGAGGAGGCCAAGGCGGTGGCCAAGAACATCGGG
AGCGAGGACATGGTCATCAAGGCCCAGGTGCTCGCGGGCGGCCGCGGCAAGGGGACGTTTGACAACGGACTCAAG
GGCGGAGTCCGCGTCATCTACTCGCCGCACGAGGCCGAGATGTTCGCCCAGCAGATGATCGGCCACAAGCTCGTG
ACCAAGCAGACGGGCGCGGGTGGCCGGCTGTGCAATGCCGTCTACATCTGCGAGCGAAAGTTTGCCCGCCGCGAG
TTTTACCTGGCCATCCTCATGGACCGCACTTCGCAGACGCCTGTCATCGTCTCGTCGTCGCAGGGCGGCATGGAC
ATCGAGACGGTGGCCAAGGAGAACCCGGAGGCGATTGTGACGACGTACATTGATATCAACAAGGGTGTGACGGAC
AACGTGGCGCGCGGCATCGCCACCAAGCTCGGCTTTAGCGATCAGTGCGTTGAGGAGGCCAAGGAGACGATCCAG
AAGCTATACAAGATATTCGAAGAGCGTGACGCGACGCAGATTGAGATCAACCCGCTATCGGAGACGTCGGATCAC
CAGGTTCTGTGCATGGACGCCAAGTTTGGCTTCGATGACAACGCCGACTTCCGGCAAAAGGAGGTGTTTGAGTGG
CGCGACACGACGCAAGAAGACGCCGACGAGGTTAGGGCCGCCAGCTCGGGCCTCAACTTCATCAAGCTCGACGGC
GACATTGGCTGTCTGGTCAATGGCGCGGGTCTGGCCATGGCGACCATGGACATTATCAAGCTCAACGGCGGGCAG
CCGGCCAACTTCCTCGACGTCGGAGGCGGCGCGACGCCGGCGGCCATCAAAGAGGCCTTTGAGCTGATCACGAGC
GACGCCAAGGTGACGGCCATCTTTGTCAACATCTTTGGCGGCATCGTGCGGTGCGACCACATTGCCAACGGGCTC
ATCAAGACGGTCGAGACGCTCAACCTCAAGATCCCCATCATCGCTCGTCTCCAGGGCACCAACGTGGAGCAGGCG
CACAAGTTGATCAACGAGTCGGGCATGAAGATCTTCTCCATCGACGACCTGCAGAGCGCGGCCGAGAAGGCGGTG
CAGCTGTCAAAGATGGTGAAGCTCGCCCGAGACATGGACGTCGGCGTCGAGTTTTCTCTGGGCATCTAG
Transcript >Ophcf2|06716
ATGTTCCGCTTCGGCCACAGCCGCGCCCTAGCGTCGGCCTTGAAGGCTTCCAATGCCCGGGTCGCGCCGTCGGCC
CGTATCCCCGGTGTTGCCCAGCAGCGGCGGGCGCTGAGCATCCACGAGTACCGATCCGCTGATCTGCTACGTCAG
TATGGAGTCGGCGTTCCCAAGGGCTCGGTGGCCCAGTCGGCCGAGGAGGCCAAGGCGGTGGCCAAGAACATCGGG
AGCGAGGACATGGTCATCAAGGCCCAGGTGCTCGCGGGCGGCCGCGGCAAGGGGACGTTTGACAACGGACTCAAG
GGCGGAGTCCGCGTCATCTACTCGCCGCACGAGGCCGAGATGTTCGCCCAGCAGATGATCGGCCACAAGCTCGTG
ACCAAGCAGACGGGCGCGGGTGGCCGGCTGTGCAATGCCGTCTACATCTGCGAGCGAAAGTTTGCCCGCCGCGAG
TTTTACCTGGCCATCCTCATGGACCGCACTTCGCAGACGCCTGTCATCGTCTCGTCGTCGCAGGGCGGCATGGAC
ATCGAGACGGTGGCCAAGGAGAACCCGGAGGCGATTGTGACGACGTACATTGATATCAACAAGGGTGTGACGGAC
AACGTGGCGCGCGGCATCGCCACCAAGCTCGGCTTTAGCGATCAGTGCGTTGAGGAGGCCAAGGAGACGATCCAG
AAGCTATACAAGATATTCGAAGAGCGTGACGCGACGCAGATTGAGATCAACCCGCTATCGGAGACGTCGGATCAC
CAGGTTCTGTGCATGGACGCCAAGTTTGGCTTCGATGACAACGCCGACTTCCGGCAAAAGGAGGTGTTTGAGTGG
CGCGACACGACGCAAGAAGACGCCGACGAGGTTAGGGCCGCCAGCTCGGGCCTCAACTTCATCAAGCTCGACGGC
GACATTGGCTGTCTGGTCAATGGCGCGGGTCTGGCCATGGCGACCATGGACATTATCAAGCTCAACGGCGGGCAG
CCGGCCAACTTCCTCGACGTCGGAGGCGGCGCGACGCCGGCGGCCATCAAAGAGGCCTTTGAGCTGATCACGAGC
GACGCCAAGGTGACGGCCATCTTTGTCAACATCTTTGGCGGCATCGTGCGGTGCGACCACATTGCCAACGGGCTC
ATCAAGACGGTCGAGACGCTCAACCTCAAGATCCCCATCATCGCTCGTCTCCAGGGCACCAACGTGGAGCAGGCG
CACAAGTTGATCAACGAGTCGGGCATGAAGATCTTCTCCATCGACGACCTGCAGAGCGCGGCCGAGAAGGCGGTG
CAGCTGTCAAAGATGGTGAAGCTCGCCCGAGACATGGACGTCGGCGTCGAGTTTTCTCTGGGCATCTAG
Gene >Ophcf2|06716
ATGTTCCGCTTCGGCCACAGCCGCGCCCTAGCGTCGGCCTTGAAGGCTTCCAATGTGCGCTCTCCCACGTGCCCG
ATGCTTCCGAGATCGCATTTGTCTCGTATCATGACAAGCTGACCTCTTGCTCCGTCACAGGCCCGGGTCGCGCCG
TCGGCCCGTATCCCCGGTGTTGCCCAGCAGCGGCGGGCGCTGAGCATCCACGAGTACCGATCCGCTGATCTGCTA
CGTCAGGTAGAAGCGACTCTTGTTCTTCCTTGCCCTGAAACTGTCGAGACTGACGGGAGTTTGACGTCGACAGTA
TGGAGTCGGCGTTCCCAAGGGCTCGGTGGCCCAGTCGGCCGAGGAGGCCAAGGCGGTGGCCAAGAACATCGGGAG
CGAGGACATGGTCATCAAGGCCCAGGTGCTCGCGGGCGGCCGCGGCAAGGGGACGTTTGACAACGGACTCAAGGG
CGGAGTCCGCGTCATCTACTCGCCGCACGAGGCCGAGATGTTCGCCCAGCAGATGATCGGCCACAAGCTCGTGAC
CAAGCAGACGGGCGCGGGTGGCCGGCTGTGCAATGCCGTCTACATCTGCGAGCGAAAGTTTGCCCGCCGCGAGTT
TTACCTGGCCATCCTCATGGACCGCACTTCGCAGACGCCTGTCATCGTCTCGTCGTCGCAGGGCGGCATGGACAT
CGAGACGGTGGCCAAGGAGAACCCGGAGGCGATTGTGACGACGTACATTGATATCAACAAGGGTGTGACGGACAA
CGTGGCGCGCGGCATCGCCACCAAGCTCGGCTTTAGCGATCAGTGCGTTGAGGAGGCCAAGGAGACGATCCAGAA
GCTATACAAGATATTCGAAGAGCGTGACGCGACGCAGATTGAGATCAACCCGCTATCGGAGACGTCGGATCACCA
GGTTCTGTGCATGGACGCCAAGTTTGGCTTCGATGACAACGCCGACTTCCGGCAAAAGGAGGTGTTTGAGTGGCG
CGACACGACGCAAGAAGACGCCGACGAGGTTAGGGCCGCCAGCTCGGGCCTCAACTTCATCAAGCTCGACGGCGA
CATTGGCTGTCTGGTCAATGGCGCGGGTCTGGCCATGGCGACCATGGACATTATCAAGCTCAACGGCGGGCAGCC
GGCCAACTTCCTCGACGTCGGAGGCGGCGCGACGCCGGCGGCCATCAAAGAGGCCTTTGAGCTGATCACGAGCGA
CGCCAAGGTGACGGCCATCTTTGTCAACATCTTTGGCGGCATCGTGCGGTGCGACCACATTGCCAACGGGCTCAT
CAAGACGGTCGAGACGCTCAACCTCAAGATCCCCATCATCGCTCGTCTCCAGGGCACCAACGTGGAGCAGGCGCA
CAAGTTGATCAACGAGTCGGGCATGAAGATCTTCTCCATCGACGACCTGCAGAGCGCGGCCGAGAAGGCGGTGCA
GCTGTCAAAGATGGTGAAGCTCGGTGAGTCCGGCCCGGTGATGAGTGACGAGACGACGAGACGCTGATACTGGTC
GGGCAGCCCGAGACATGGACGTCGGCGTCGAGTTTTCTCTGGGCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail