Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06705
Gene name
Locationscaffold_08:847407..849474
Strand+
Gene length (bp)2067
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F 7.5E-75 379 587
PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF 2.8E-07 295 374

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1523 0.8556 0.1918 0.0065 0.1846 0.0698 0.0458 0.0063 0.081 0.0005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3122
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|319
Ophiocordyceps australis map64 (Brazil) OphauB2|3309
Ophiocordyceps camponoti-floridani Ophcf2|06705 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5053
Ophiocordyceps kimflemingae Ophio5|1565
Ophiocordyceps subramaniannii Hirsu2|5472

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06705
MGAGRRMSRKQGPPEALSEEHFARLKRKAGLPVDRPSEEPKKRRRTAKGAEAKKGERNGSVGSKKGQKKEKRPTN
GKVNGNGKYKGKKPPPASDLSPEADELDDEFDLDKMAPSTDEEDDEVREGKGPRLGADFLGSDSEQDSSVFDSDD
EAITRKHVFSEDEDESDAEAKLTAANMESLSRQLDRAAADDAAADAAEMAESALQTNMTGEKPPQVLDDEEDGTQ
TKSNPLLLAPDLQLLRLRMTETVRVLDDFAKLSEQGRSRSEYTAQLIKDICAYYGYSEYLAEKLYGLFSPREALA
FFEANETARPVVIRTNTLRTHRRDLAQALINRGVTLEPVGKWSKVGLQVFESSVPLGATPEYLAGHYILQAASSF
LPCVALDPQERERVLDMAAAPGGKTTYMAAMMKNTGVIVANDANKARAKGLIGNIHRLGASNVIVSNYDARLFPK
PMGGFDRVLLDAPCSGTGVIAKDASIKTNKTETDFLRLPHVQKQLLLSAIDSVNHSSRSGGYLVYSTCSVTVEEN
EQVVQYALSRRPNVRLVETGLAFGKEGFTSFRGKRFDASLRFTRRYYPHAHNVDGFFVAKFKKIAASPTTTTSTS
TTSTTTTTTTTKAETTTEDGDVVAEALHQKIPLAADDDNGKDEEGDGFGGWHDEEDKLYMERGRRNAMRRRGLDP
KCDGKAAASKGNK*
Coding >Ophcf2|06705
ATGGGTGCCGGACGTCGCATGTCGAGGAAGCAGGGACCGCCTGAGGCCCTTTCGGAGGAACACTTTGCGCGGTTA
AAACGGAAAGCCGGTCTTCCGGTTGATCGTCCATCGGAGGAGCCCAAGAAGAGGAGAAGAACGGCCAAGGGTGCT
GAAGCGAAGAAGGGCGAGAGAAACGGCTCCGTCGGCTCGAAAAAGGGTCAGAAGAAGGAGAAGAGACCGACAAAC
GGCAAGGTCAATGGCAATGGCAAATACAAGGGCAAGAAGCCGCCGCCGGCGTCTGATTTGAGCCCTGAAGCCGAC
GAGCTGGATGACGAGTTTGACCTCGACAAGATGGCCCCGTCGACCGATGAAGAGGATGACGAGGTAAGAGAGGGA
AAAGGACCGAGACTGGGAGCCGACTTTCTTGGCTCGGACTCGGAGCAGGACTCGTCCGTCTTCGACTCGGATGAC
GAAGCGATCACCAGGAAACACGTCTTTTCCGAGGACGAGGATGAATCGGACGCCGAGGCAAAGCTCACGGCCGCC
AACATGGAGTCTCTCTCGCGACAGTTGGACCGAGCCGCTGCCGACGACGCGGCCGCCGACGCTGCGGAGATGGCT
GAGAGCGCGCTGCAGACTAACATGACGGGCGAGAAGCCGCCGCAGGTGTTGGACGACGAGGAAGACGGGACGCAG
ACCAAGTCGAATCCCCTGTTGCTCGCGCCGGATCTTCAGCTCCTCCGGTTGAGGATGACGGAGACGGTCCGCGTG
TTGGACGACTTCGCCAAGCTTTCGGAGCAAGGCCGGTCGCGGTCCGAGTACACGGCTCAGCTGATCAAGGACATC
TGCGCATACTACGGGTACTCGGAGTATCTGGCAGAGAAGCTATACGGTCTCTTCTCGCCACGCGAGGCCCTCGCC
TTCTTCGAGGCCAACGAGACGGCACGTCCGGTCGTGATCCGAACCAACACGTTGCGGACGCACCGACGCGACCTC
GCGCAGGCCCTCATCAACCGAGGCGTCACTCTCGAACCCGTCGGCAAGTGGTCCAAGGTCGGACTGCAGGTGTTT
GAGAGCAGCGTCCCGCTCGGAGCAACGCCCGAGTATCTGGCCGGTCACTACATCCTCCAGGCGGCCTCTTCCTTC
CTACCGTGCGTCGCGCTCGATCCGCAGGAGAGGGAGCGCGTGCTGGACATGGCTGCCGCGCCGGGCGGAAAGACG
ACGTACATGGCGGCCATGATGAAGAACACGGGCGTCATCGTGGCCAACGACGCCAACAAGGCACGTGCCAAGGGT
CTCATCGGGAACATCCACCGCCTGGGCGCCAGCAACGTCATCGTATCCAACTACGACGCCCGTCTCTTCCCCAAG
CCAATGGGCGGTTTCGACCGCGTCCTCCTCGACGCCCCCTGCTCCGGAACAGGCGTCATCGCAAAGGACGCCAGC
ATAAAGACCAACAAGACGGAAACGGACTTTTTACGTCTCCCCCACGTGCAGAAGCAGCTCCTCCTCTCGGCCATC
GACTCGGTCAACCACTCGAGCCGATCGGGCGGCTACCTCGTCTACTCGACCTGTTCGGTGACGGTGGAGGAGAAC
GAGCAGGTGGTTCAGTACGCGCTCAGCCGACGGCCCAACGTCCGCCTCGTCGAAACGGGCCTCGCCTTTGGAAAG
GAAGGCTTCACCAGCTTCCGCGGCAAGAGATTCGATGCTAGCTTGAGGTTTACCCGGAGGTATTACCCTCACGCC
CACAACGTCGACGGCTTCTTTGTCGCAAAGTTTAAGAAGATTGCCGCTTCTCCTACTACTACTACTTCTACTTCT
ACTACTTCTACTACTACTACTACTACTACTACCAAAGCGGAGACGACGACCGAGGATGGTGACGTTGTGGCTGAA
GCTCTACATCAGAAGATTCCCCTCGCTGCCGACGATGACAATGGTAAAGACGAGGAGGGTGATGGCTTTGGAGGG
TGGCATGATGAAGAGGATAAGCTTTACATGGAGAGAGGTAGACGCAACGCCATGAGGAGGCGAGGCCTTGATCCC
AAGTGTGATGGGAAGGCAGCCGCCTCCAAGGGAAACAAATAG
Transcript >Ophcf2|06705
ATGGGTGCCGGACGTCGCATGTCGAGGAAGCAGGGACCGCCTGAGGCCCTTTCGGAGGAACACTTTGCGCGGTTA
AAACGGAAAGCCGGTCTTCCGGTTGATCGTCCATCGGAGGAGCCCAAGAAGAGGAGAAGAACGGCCAAGGGTGCT
GAAGCGAAGAAGGGCGAGAGAAACGGCTCCGTCGGCTCGAAAAAGGGTCAGAAGAAGGAGAAGAGACCGACAAAC
GGCAAGGTCAATGGCAATGGCAAATACAAGGGCAAGAAGCCGCCGCCGGCGTCTGATTTGAGCCCTGAAGCCGAC
GAGCTGGATGACGAGTTTGACCTCGACAAGATGGCCCCGTCGACCGATGAAGAGGATGACGAGGTAAGAGAGGGA
AAAGGACCGAGACTGGGAGCCGACTTTCTTGGCTCGGACTCGGAGCAGGACTCGTCCGTCTTCGACTCGGATGAC
GAAGCGATCACCAGGAAACACGTCTTTTCCGAGGACGAGGATGAATCGGACGCCGAGGCAAAGCTCACGGCCGCC
AACATGGAGTCTCTCTCGCGACAGTTGGACCGAGCCGCTGCCGACGACGCGGCCGCCGACGCTGCGGAGATGGCT
GAGAGCGCGCTGCAGACTAACATGACGGGCGAGAAGCCGCCGCAGGTGTTGGACGACGAGGAAGACGGGACGCAG
ACCAAGTCGAATCCCCTGTTGCTCGCGCCGGATCTTCAGCTCCTCCGGTTGAGGATGACGGAGACGGTCCGCGTG
TTGGACGACTTCGCCAAGCTTTCGGAGCAAGGCCGGTCGCGGTCCGAGTACACGGCTCAGCTGATCAAGGACATC
TGCGCATACTACGGGTACTCGGAGTATCTGGCAGAGAAGCTATACGGTCTCTTCTCGCCACGCGAGGCCCTCGCC
TTCTTCGAGGCCAACGAGACGGCACGTCCGGTCGTGATCCGAACCAACACGTTGCGGACGCACCGACGCGACCTC
GCGCAGGCCCTCATCAACCGAGGCGTCACTCTCGAACCCGTCGGCAAGTGGTCCAAGGTCGGACTGCAGGTGTTT
GAGAGCAGCGTCCCGCTCGGAGCAACGCCCGAGTATCTGGCCGGTCACTACATCCTCCAGGCGGCCTCTTCCTTC
CTACCGTGCGTCGCGCTCGATCCGCAGGAGAGGGAGCGCGTGCTGGACATGGCTGCCGCGCCGGGCGGAAAGACG
ACGTACATGGCGGCCATGATGAAGAACACGGGCGTCATCGTGGCCAACGACGCCAACAAGGCACGTGCCAAGGGT
CTCATCGGGAACATCCACCGCCTGGGCGCCAGCAACGTCATCGTATCCAACTACGACGCCCGTCTCTTCCCCAAG
CCAATGGGCGGTTTCGACCGCGTCCTCCTCGACGCCCCCTGCTCCGGAACAGGCGTCATCGCAAAGGACGCCAGC
ATAAAGACCAACAAGACGGAAACGGACTTTTTACGTCTCCCCCACGTGCAGAAGCAGCTCCTCCTCTCGGCCATC
GACTCGGTCAACCACTCGAGCCGATCGGGCGGCTACCTCGTCTACTCGACCTGTTCGGTGACGGTGGAGGAGAAC
GAGCAGGTGGTTCAGTACGCGCTCAGCCGACGGCCCAACGTCCGCCTCGTCGAAACGGGCCTCGCCTTTGGAAAG
GAAGGCTTCACCAGCTTCCGCGGCAAGAGATTCGATGCTAGCTTGAGGTTTACCCGGAGGTATTACCCTCACGCC
CACAACGTCGACGGCTTCTTTGTCGCAAAGTTTAAGAAGATTGCCGCTTCTCCTACTACTACTACTTCTACTTCT
ACTACTTCTACTACTACTACTACTACTACTACCAAAGCGGAGACGACGACCGAGGATGGTGACGTTGTGGCTGAA
GCTCTACATCAGAAGATTCCCCTCGCTGCCGACGATGACAATGGTAAAGACGAGGAGGGTGATGGCTTTGGAGGG
TGGCATGATGAAGAGGATAAGCTTTACATGGAGAGAGGTAGACGCAACGCCATGAGGAGGCGAGGCCTTGATCCC
AAGTGTGATGGGAAGGCAGCCGCCTCCAAGGGAAACAAATAG
Gene >Ophcf2|06705
ATGGGTGCCGGACGTCGCATGTCGAGGAAGCAGGGACCGCCTGAGGCCCTTTCGGAGGAACACTTTGCGCGGTTA
AAACGGAAAGCCGGTCTTCCGGTTGATCGTCCATCGGAGGAGCCCAAGAAGAGGAGAAGAACGGCCAAGGGTGCT
GAAGCGAAGAAGGGCGAGAGAAACGGCTCCGTCGGCTCGAAAAAGGGTCAGAAGAAGGAGAAGAGACCGACAAAC
GGCAAGGTCAATGGCAATGGCAAATACAAGGGCAAGAAGCCGCCGCCGGCGTCTGATTTGAGCCCTGAAGCCGAC
GAGCTGGATGACGAGTTTGACCTCGACAAGATGGCCCCGTCGACCGATGAAGAGGATGACGAGGTAAGAGAGGGA
AAAGGACCGAGACTGGGAGCCGACTTTCTTGGCTCGGACTCGGAGCAGGACTCGTCCGTCTTCGACTCGGATGAC
GAAGCGATCACCAGGAAACACGTCTTTTCCGAGGACGAGGATGAATCGGACGCCGAGGCAAAGCTCACGGCCGCC
AACATGGAGTCTCTCTCGCGACAGTTGGACCGAGCCGCTGCCGACGACGCGGCCGCCGACGCTGCGGAGATGGCT
GAGAGCGCGCTGCAGACTAACATGACGGGCGAGAAGCCGCCGCAGGTGTTGGACGACGAGGAAGACGGGACGCAG
ACCAAGTCGAATCCCCTGTTGCTCGCGCCGGATCTTCAGCTCCTCCGGTTGAGGATGACGGAGACGGTCCGCGTG
TTGGACGACTTCGCCAAGCTTTCGGAGCAAGGCCGGTCGCGGTCCGAGTACACGGCTCAGCTGATCAAGGACATC
TGCGCATACTACGGGTACTCGGAGTATCTGGCAGAGAAGCTATACGGTCTCTTCTCGCCACGCGAGGCCCTCGCC
TTCTTCGAGGCCAACGAGACGGCACGTCCGGTCGTGATCCGAACCAACACGTTGCGGACGCACCGACGCGACCTC
GCGCAGGCCCTCATCAACCGAGGCGTCACTCTCGAACCCGTCGGCAAGTGGTCCAAGGTCGGACTGCAGGTGTTT
GAGAGCAGCGTCCCGCTCGGAGCAACGCCCGAGTATCTGGCCGGTCACTACATCCTCCAGGCGGCCTCTTCCTTC
CTACCGTGCGTCGCGCTCGATCCGCAGGAGAGGGAGCGCGTGCTGGACATGGCTGCCGCGCCGGGCGGAAAGACG
ACGTACATGGCGGCCATGATGAAGAACACGGGCGTCATCGTGGCCAACGACGCCAACAAGGCACGTGCCAAGGGT
CTCATCGGGAACATCCACCGCCTGGGCGCCAGCAACGTCATCGTATCCAACTACGACGCCCGTCTCTTCCCCAAG
CCAATGGGCGGTTTCGACCGCGTCCTCCTCGACGCCCCCTGCTCCGGAACAGGCGTCATCGCAAAGGACGCCAGC
ATAAAGACCAACAAGACGGAAACGGACTTTTTACGTCTCCCCCACGTGCAGAAGCAGCTCCTCCTCTCGGCCATC
GACTCGGTCAACCACTCGAGCCGATCGGGCGGCTACCTCGTCTACTCGACCTGTTCGGTGACGGTGGAGGAGAAC
GAGCAGGTGGTTCAGTACGCGCTCAGCCGACGGCCCAACGTCCGCCTCGTCGAAACGGGCCTCGCCTTTGGAAAG
GAAGGCTTCACCAGCTTCCGCGGCAAGAGATTCGATGCTAGCTTGAGGTTTACCCGGAGGTATTACCCTCACGCC
CACAACGTCGACGGCTTCTTTGTCGCAAAGTTTAAGAAGATTGCCGCTTCTCCTACTACTACTACTTCTACTTCT
ACTACTTCTACTACTACTACTACTACTACTACCAAAGCGGAGACGACGACCGAGGATGGTGACGTTGTGGCTGAA
GCTCTACATCAGAAGATTCCCCTCGCTGCCGACGATGACAATGGTAAAGACGAGGAGGGTGATGGCTTTGGAGGG
TGGCATGATGAAGAGGATAAGCTTTACATGGAGAGAGGTAGACGCAACGCCATGAGGAGGCGAGGCCTTGATCCC
AAGTGTGATGGGAAGGCAGCCGCCTCCAAGGGAAACAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail